5. describe the trend in the presence of smooth muscle as one proceeds from the larger structures of the respiratory tree, to the smaller structures. what effect does each of the two divisions of the autonomic nervous system (ans) have on this smooth muscle?

Answers

Answer 1

As one proceeds from the larger structures of the respiratory tree, such as the trachea, to the smaller structures, such as the bronchioles, the presence of smooth muscle decreases.

The trachea and bronchi contain a thick layer of smooth muscle, allowing for strong contractions and dilation of the airways. However, as the bronchioles become smaller, the smooth muscle layer becomes thinner and less prominent.

The two divisions of the autonomic nervous system (ANS), the sympathetic and parasympathetic systems, have different effects on the smooth muscle of the respiratory tree. The sympathetic nervous system is responsible for the "fight or flight" response and causes the airways to constrict and the heart rate to increase. This can lead to bronchoconstriction, making it harder to breathe. On the other hand, the parasympathetic nervous system is responsible for the "rest and digest" response and causes the airways to dilate and the heart rate to decrease. This can lead to bronchodilation, making it easier to breathe.

Learn more about autonomic nervous system here:

https://brainly.com/question/9515388

#SPJ4

Related Questions

this tissue type can perform absorption or secretion in the body.

Answers

In your body, epithelial tissue can perform protection, secretion, and absorption.

The epithelium, which is the main tissue in glands, is a type of body tissue that covers all of your body's internal and external surfaces, lines body cavities, and lines hollow organs. The functions of epithelial tissue might vary depending on where it is in the body, including absorption, secretion, and defense.

The smallest biological unit capable of independent life is a cell. Cells make up all living things, including the tissues in your body.

Kidney tubules and glandular (secreting) tissue frequently contain simple cuboidal epithelium.

Apical cilia or microvilli are typically present in simple columnar epithelium, which is frequently specialized for absorption. Your intestines and stomach are lined by these cells.

To know more about epithelial tissue

brainly.com/question/13404204

#SPJ4

the trna anticodon, gac, is complementary to the mrna codon with the sequence _____.
CAG
CTG
GAC
CUG
TCG

Answers

The correct option is D ; CUG , We may use a codon table to identify whether the codon CUG codes for Leu or leucine.

Ribosomes will read codons on an mRNA sequence to produce a functioning protein with the aid of transfer RNAs. Any CUG codon inside an mRNA sequence will only code for leucine and nothing else.

During translation, a free ribosome will read an mRNA sequence and manufacture a polypeptide that will become a functional protein. The mRNA sequence will be read as codons, which are three-nucleotide sequences. One amino acid will be coded by one codon. An amino acid, on the other hand, may be coded for by several codons.

Learn more about to codon

https://brainly.com/question/9382652

#SPJ4

1. (i) What biological knowledge or study is required in dealing with locusts that infest a maize
(ii) State the functions of the following cell structures.
(a) Sapvacuole.
(b) Nucleolus.

Answers

Answer:

Hope this helps found them on the web.

Explanation:

I- Control of grasshopper sand locusts has traditionally relied on synthetic insecticides, and for emergency situations this is unlikely to change. However, a grow-ing awareness of the environmental issues associated with acridid control as well as the high costs of emergency control are expanding the demand for biological control. In particular, preventive, integrated control strategies with early interventions will reduce the ﬁnancial and environmental costs associated with large-scale plague treatments.The recent development of effective oil formulations of Metarhizium anisopliae sporesin Africa, Australia, and Brazil opens new possibilities for environmentally safe con-trol operations. Metarhizium biopesticide kills 70%–90% of treated locusts within14–20 days, with no measurable impact on nontarget organisms. An integrated pest management strategy, with an emphasis on the use of Metarhizium, that incorporate srational use of chemical pesticides with biological options such as the micro sporid-ian Nosema locustae and the hymenopteran egg parasitoids Scelio spp., has become arealistic option.

ii- a) It creates a sealed compartment within the cell that is filled with water, dissolved inorganic and organic molecules (enzymes). It stores food and a range of nutrients that the cell requires to thrive, as well as waste products that protect the cell from contamination

b)The primary function of the nucleolus is in facilitating ribosome biogenesis, through the processing and assembly of rRNA into prerbosomal particles. OR is where ribosomes are made.

Which of the following is used by plants
to attract pollinators?
A. ovary size
B. stamen length
C. sweet-tasting fruit
D. cellulose

Answers

Answer:

C. sweet-tasting fruit

Explanation:

true/false. Ribosomes provide the scaffolding on which tRNAs interact with mRNA during translation of an mRNA sequence to a chain of amino acids. A ribosome has three binding sites, each of which has a distinct function in the tRNA-mRNA interactions.

Answers

It will Leave site E open because on In site P, the codon with A U A at the bottom goes at the place, or it's the one that has three things on top rather than the one circle.

On the other hand In site A the codon with U C C at the bottom goes at the place , and it has just a circle attached to the top. In general, ribosomal subunits gets assemble together and forms a sandwich like structure on the strand of mRNA, from this place they starts to attract tRNA molecules tethered to amino acids (circles). As a result a long chain of amino acids molecules ger emerged when ribosome starts decoding the mRNA sequence results to polypeptide or new protein.

So , Ribosomes helps to provide the scaffolding structure on tRNAs that interact with mRNA during translation of an mRNA sequence to the amino acid chain .

To learn more about Ribosomes , here

brainly.com/question/1604076

#SPJ4

glucose and ? are the product of photosynthesis .

Answers

Answer:

glucose and oxygen are the products

Answer:

hope it helps

Explanation:

The products of photosynthesis are glucose and oxygen

Natural selection acts only on traits that are _____.a. advantageous in a certain environmentb. advantageousc. heritabled. disadvantageous

Answers

Only heritable features in the population are affected by natural selection, which favours b. advantageous alleles by increasing their frequency in the population while favouring detrimental alleles by decreasing their frequency. This process is known as adaptive evolution.

Evolution is the shift through time in the inherited traits of biological populations. Genes, which are transmitted from parent to offspring during reproduction, express themselves in the form of certain traits. As a result of genetic recombination and mutation, variation frequently exists within a particular population. When these variations are subjected to evolutionary processes like natural selection (which includes sexual selection) and genetic drift, they give rise to evolution, which is when particular traits within a population start to become more or less prevalent. A change in heritable features emerges across successive generations as a result of the shifting evolutionary pressures that determine whether a trait is frequent or rare within a population. Every level of biological organisation, including has experienced the emergence of biodiversity as a result of this process of evolution.

Learn more about Evolution here:

https://brainly.com/question/13492988

#SPJ4

aamc 2022 free practice exam bbquestion a particular diploid organism is heterozygous in each of 3 unlinked genes. considering only these 3 genes, how many different types of gametes can this organism produce?

Answers

A diploid organism is one that has two sets of chromosomes, one set inherited from each parent. A diploid organism that is heterozygous for a gene has two different alleles for that gene, one inherited from each parent.

If an organism is heterozygous in each of the 3 unlinked genes, it means that for each of these genes, the organism has two different alleles, one inherited from each parent. Since these genes are unlinked, meaning they are located on different chromosomes, the alleles for each gene are inherited independently of one another.

In terms of gamete production, each parent contributes one allele for each gene to the offspring. The number of different types of gametes that can be produced by a heterozygous organism for a particular gene is 2.

For 3 unlinked genes, the number of different types of gametes that can be produced is 2^3 = 8. So, the diploid organism in this scenario can produce 8 different types of gametes.

To learn more about chromosomes

https://brainly.com/question/1596925

#SPJ4

Other Questions

given that a 300-k blackbody radiates its peak energy at a wavelength of about 10 mm, at what wavelength would a 600-k blackbody radiate its peak energy? b. if the two bodies in part (a) were the same size, what would be the ratio of the heat emitted by the hotter object to the heat emitted by the colder one glucose and ? are the product of photosynthesis . which of the changes would keep then hanger in balance? select all that apply aamc 2022 free practice exam bbquestion a particular diploid organism is heterozygous in each of 3 unlinked genes. considering only these 3 genes, how many different types of gametes can this organism produce? Ah, happy, happy boughs! that cannot shed Your leaves, nor ever bid the Spring adieu; And, happy melodist, unwearied, For ever piping songs for ever new Write two to four sentences comparing the themes of the two poems. Use evidence from the texts to support your answer. The Cold War 4. Why is this sporting event (in the light of the Cold War conflict)? 8.why is it impossible for bruno to understand what is going on around him, even when shmuel tries to explain it to him? 30 POINTS ASAP America at the Turn of the Centuryadapted from the Library of Congress By 1900 the American nation had established itself as a world power. The West was won. The frontier was no more. The continent was settled from coast to coast. Apache war chief Geronimo had surrendered in 1886. Defeat of the Sioux at the battle of Wounded Knee in 1891 had brought the Indian Wars to a close. By 1900 American Indians were on reservations and the buffalo were gone. Homesteading and the introduction of barbed wire in 1874 had brought an end to the open range. The McCormick reaper had made large-scale farming profitable. In 1900, the U.S. was by far the world's largest agricultural producer. The first transcontinental rail link had been completed in 1869. Three decades later, in 1900, the nation had 193,000 miles of track, with five railroad systems spanning the continent. The world's first oil well had been drilled in Titusville, Pennsylvania, in 1859. By 1900, major oil fields were being tapped in Kansas, Illinois, Louisiana, Oklahoma, and Texas. The supply of American oil seemed limitless. John D. Rockefeller's Standard Oil Trust dominated the world's petroleum markets. It controlled more than 90 percent of the nation's refinery capacity. At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced. In the 1880s Andrew Carnegie had constructed the world's largest steel mill in Pittsburgh, Pennsylvania. By 1900, the United States was the largest steel producer in the world, turning out 10,000,000 tons a year. Henry Ford had built his first gasoline engine car in 1892 and the world's first auto race was held in Chicago in 1896. With the founding of the Ford Motor Company in 1903, the age of the automobile was underway. By 1900, telephones were in wide use. Cities were being electrified. Moving pictures were a curiosity. Guglielmo Marconi was conducting experiments that would lead to the development of the radio, and the Wright brothers were at work on a heavier-than-air flying machine. Cities were growing. New wealth and devastating fires produced a boom in urban construction. Architects Richardson, Hunt, McKim, Mead, and White flourished. Sullivan pioneered the skyscraper and his protg, Frank Lloyd Wright, was beginning his career in Chicago. This was a time of both confidence and ferment. In the cities and the states, political "Progressives" were coming to power, experimenting with reforms such as women's suffrage, direct election of United States senators, the initiative, recall, the Australian ballot, primary elections, and laws setting minimum wages, work standards, and regulated rates for common carriers and services. Followers of the Progressive movement believed in the perfectibility of man and his society. Republican William McKinley of Ohio was elected president in 1896 and re-elected in 1900. He had been preceded by Democrat Grover Cleveland. McKinley looked every inch a president. Young reporter William Allen White said of him after an interview: "He was the statue in the park speaking." A dignified, reserved man, McKinley was the last of the old-style, low-key presidents. McKinley was the last of five Civil War veterans to serve in the White House, signaling the end of the post-war era. He was also the fifth of the six Ohio presidents to serve during the fifty-year period 1868-1908. McKinley is generally considered to have been a good but weak man. He would be followedand overshadowedby Theodore ("Teddy") Roosevelt, who was vice-president when McKinley was assassinated in 1901. Later, Roosevelt would be elected president in his own right. The ascendancy of Ohio and the Midwest in national politics demonstrated that the United States was no longer a nation oriented to the Atlantic seaboard. It stretched, as the anthem, America the Beautiful, put it, "from sea to shining sea."Select all the correct answers.Read the sentence from "America at the Turn of the Century."At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced.Which three sentences correctly paraphrase the sentence?A. A nation's industry was considered powerful by the number of tons of steel it produced (Library of Congress). B. In the late 19th century, it was the amount of steel produced that showed how powerful a nation's industry was (Library of Congress). C. A nation's industry was considered powerful only if it managed to produce a large quantity of steel (Library of Congress). D. At the turn of the century, the number of tons of steel helped determine the strength of a nation (Library of Congress). E. The quantity of steel produced helped determine the strength of a national industry (Library of Congress). which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge? ache mothers, in paraquay, carry their young children almost all the time to protect them from getting hurt in the forest. consequently, their children walk almost a year later than american children. based on this example, do you think it is the impact of nature, nurture, both or neither that influenced this cultural difference? You develop and deploy several microservices to an Azure Kubernetes Service (AKS) cluster. The microservices are instrumented with the Application Insights SDK. You configure an Application Insights instance and use the connection string in the instrumentation.The instrumentation includes a custom telemetry value used to track the order checkout action. Order checkout is an action that includes a property to capture the order number.You need to capture the custom order telemetry.Which Application Insights data type should you use?Select only one answer.tracedependencymetricevent Otis wants to borrow 10000 to buy a used car. he examined his budget and decided that he can afford a payment of $200 a month. if his bank offers him a rate of 7.5%, how long should he borrow the money so he can afford his monthly payment? two harmonic waves are described by y1= (4m) sin (8/mx-300/s t) y2=(4m) sin (8/mx-300/s t-2) what is the wavelength of the resultant wave ? Below you will find the yearly average values of the Dow Jones Industrial Average, the most popular index of stock market prices, for five different years. The Consumer Price Index for each year (on a base of 1982- 1984 = 100) can be found on the inside back cover of this book. Use these numbers to deflate all five stock market values. Do real stock prices always rise every decade?Year Dow Jomes Industrial Average1970 7531980 8911990 2,8792000 10,7352010 10,663 DXL Practice with algebrai XDL | Identify equivalent in X Q Algebra It A Common Cor X DAt the start of the softball x GIdentify equivalent linear Xbd.com/math/grade-7/identify-equivalent-linear-expressions-word-problems?signinRedirect=https%3A%2F%2Fwww.ixl.com%2Fsignin%2 R.23 Identify equivalent linear expressions: word problems KWH>120xx + 1.2xSubmitAlec's parents give him x dollars per month for his allowance. However, since his birthday isin February, he gets an extra 20% bonus that month.Pick all the expressions that represent how much Alec's allowance is in February.x + 0.2x+1.2x*DX Consider the deflection (based on choices of E and I) and the weight of the material. How would you find a balance between the needed structural performance and weight? what decreases the possibility that errors will be caught and the potential for fraud will be increased? The measure of angle JKL is 145.The measure of angle MKL is 60.The measure of angle JKM is x.Find the value of x.X=0X5XK145M60D the dominican republic has 10.7 million people and a national population growth rate of 1.5 percent. paraguay has 6.8 million people and a national population growth rate of 1.5 percent. in how many years will each country double in size? sean is one of several general partners who own pints and cans, a small chain of bar and grills located in illinois and indiana. sean is interested in converting the partnership into a master limited partnership. if he convinces other partners to go along with his idea, pints and cans will select one: a. offer shares of ownership that are traded on a stock exchange much like a corporation. b. pay its taxes like a corporation. c. begin to operate much like a sole proprietorship. d. have to change its name to include the term ltd. in its title to indicate its owners have limited liability.