6. The French and Indian War was ultimately a land dispute between and The French and Indian War was ultimately a land dispute between and?​

Answers

Answer 1

Answer:

France And Great Britain

What was the French Indian War?​

The war in America in which France and its Indian allies opposed England 1754-60: ended by Treaty of Paris in 1763. The Treaty of Paris is the agreement between the Kingdom of Great Britain and its 13 former colonies in North America, now known as the United States of America.

#SPJ2


Related Questions

What defined the mystery religions and how were they different from earlier Roman cults

Answers

Mystery religions started originally in tribal ceremonies that have been carried out via way of means of primitive peoples in lots of components of the world.

What are mystery religions?

The diverse mystery cults of the Greco-Roman world that provided people with non-secular studies which are not provided via way of means of the legitimate public religions can be referred to as mystery religions.

Religion belongs to the broader culture and its adherents come and cross freely whereas a cult has a tendency to be counter-cultural, prescribing the social life of its adherents to different cult members. The cult's main feature is the axis Mundi, the shamanic chief in the middle of the organization.

hence, in this way, cults were different from religions.

Learn more about mystery religions:

https://brainly.com/question/14332107

#SPJ1

What was the main purpose of the Office of War Information?

Answers

United States Office of War Information-was a United States government agency created during World War II to consolidate existing government information services and deliver propaganda both at home and abroad.


Political instability in the emerging Latin American countries was due in part to?

cultural similarities
conflicting views on government
better education for all
increased trade and commerce


Answers

Answer:

B Conflicting views on government

Explanation:

Answer:

B is the correct answer

Explanation:

What led many Englishmen to search for new opportunities in the new world during the 17th century?

Answers

Answer:

Freedom of faith was a big motivation for the English. In 1620, a group of settlers left England to seek the New World. Many were separatists, who believed the Church of England was dishonorable. By seeking out the New World, they were trying to break away and worship their own faith.

Question 35 of 35
How was the Lowell system different from other ways of organizing labor in
the textile industry?

Answers

Answer:

A. was more efficient.

B. was designed to minimize the dehumanizing effects of industrial labor by paying employees in cash

C. hired young adults instead of children to run the equipment.

D. they offered employment for certain amount of years.

E. they also provided employees with education opportunities, therefore to help the employees to be able to find better and higher paying jobs later in life.

Early civil rights ?

Answers

mid-1950s

When did the American civil rights movement start? The American civil rights movement started in the mid-1950s. A major catalyst in the push for civil rights was in December 1955, when NAACP activist Rosa Parks refused to give up her seat on a public bus to a white man.

The following statements are all part of one argument.

Which one is the conclusion?

a.)
Jeremy is a jazz musician.

b.)
Most musicians are financially irresponsible.

c.)
Jazz musicians are all financially irresponsible.

d.)
Jeremy is financially irresponsible.

Answers

Answer:

a.) Jeremy is a jazz musician.

Explanation:

Let's analyze each option.

Option B, D, and C all seem to be opinions, and the way we can figure this out is by taking a look at the word irresponsible. This word is mostly used in opinions (which typically is a argument). It is a way to describe something or someone's action as not careful. In the sentence options, each of the subject are being described as irresponsible (and to describe specifically, "financially irresponsible.") .

The conclusion is option A. This is because it is not arguing anything and is not showing a opinion. Someone could conclude that the subject of the sentence which is someone named Jeremy is a jazz musician based off certain circumstances. They could conclude this.

Cheers,

ROR

Jeremy is a jazz musician is a conclusion. The correct option is A. An argument's premise is a claim that justifies or supports the conclusion. In a single argument, there may be one or several premises.

What is a statement in an argument?

An argument's premise is a claim that justifies or supports the conclusion. In a single argument, there may be one or several premises. A conclusion is a sentence in an argument that expresses what the speaker is trying to persuade the reader or listener to believe.

An argument must have at least two premises, a conclusion, and one or more supporting statements. Analyze the passage to see if it makes an argument. Identify the premises and conclusion if the passage does indeed contain an argument. Arguments consist of two parts, known as premises and conclusions. The argument's premises support its conclusion. The following example shows how disagreements can come up in casual conversations.

Thus, the ideal selection is option A.

Learn more about an argument here:

https://brainly.com/question/9860191

#SPJ2

Write a discussion with can argument - a claim or thesis statement - that you can support with historical evidence. The historical evidence may come from the chapter (the image above), Please make sure you re-write all information into your own words, and make sure your original post is at least 250 words.

Answers

The question above wants to analyze your reading and reasoning skills. For that reason, I can't answer it, but I'll show you how to do it.

Steps to build the argumentRead the indicated text and reread it until your complete understanding.Identify a claim that must be defended.Present this statement according to your opinion of the text.Show sentences from the text that prove this statement to be true.

An argument is an opinion supported by evidence. Therefore, to write your argument you must stretch the text presented and determine an opinion on the subject addressed.

Learn more about arguments:

https://brainly.com/question/3775579

#SPJ1

Answer the following questions to the best of your ability in a 300-word essay. You may use the Internet or other research materials to find information about the Taliban and U.S. foreign policy.

1. How did helping the Taliban defeat Russia during the Afghanistan War help the Taliban in their efforts to resist United Nations forces today?

2. In your opinion, is helping the "lesser of two evils" a sound foreign policy decision, or should the United States allow warring nations to decide matters for themselves?

Answers

1. Helping Taliban defeat Russia during Aghanistan war helped them to resist UN forces as they had training and arms which they were given by US and it's allies to defeat Russia.

2. No, US should allow warring nations to decide matters themselves rather than supporting any of them.

1.

The United States of America and other allies supported Afghanistan during the Afghan-Soviet War as it fought the Soviet Union. At the period, the region was characterized by political unrest and conflict between the top mujahedeen organizations. As a result, the nation's allies searched for a fighting group that had a good chance of defeating the Soviet Union. As a result, the Taliban group started to receive training and equipment from the US government through the CIA department and the Pakistani military. For instance, the Pakistani army provided the best weapons and taught the Taliban in military tactics.The Pakistanis assisted in enlisting Muslims from around the world who had received military training in designated camps . After a few years, the Taliban started engaging in the same unethical behavior that had prompted the overthrow of the prior government. As a result, the UN designated the Taliban as a terrorist organization. The Taliban used the same tactics they had been taught to combat the Russians when the United Nations dispatched forces to battle them. They understood that engaging the member nations directly would damage the Organization's position in the conflict.

2.

No , The United States should not be involved in the matter of two warring nations As seen in the past whenever US tries to intervene it actually causes more casualities more deaths and more destructionThe country which is favored by US gets weapons of mass destructions and it ultimately when the sides being favored wins they turn out to become a more violent organization, as seen in the past.

Learn more about Soviet-Afghan war here:

https://brainly.com/question/14871487

#SPJ10

What completes the diagram

Answers

Answer:

in my opinion

Explanation:

Banks were important as financial supporters

please mark me brainlist

what were the problems in the path of making for new constitution for south Africa​

Answers

Answer:

The problems were faced by South Africa in framing the new constitution was the whites and the blacks in the modern republic were uniting to live collectively as equals.

Blacks have fears in their mind and desired to safeguard their interests. The black majority was enthusiastic to assure that the democratic system of majority government was not negotiated. They wanted substantial, cultural and financial rights. Moreover , the white minority was intended to preserve its privileges and property.

Explanation:

Answer:

The problem faced was that there were so many people of different color and cast and they needed constitution for all, which would be acceptable to all.... Black and white agreed to forget past and blacks shouldn't forget all atrocities done by whites and they shouldn't be thrown out of power.

What was apartheid?
-decolonization
-separation of tribes
-independence from other countries
-separation of Whites and non-Whites
-new found freedoms

Answers

The best representation of apartheid from the answer choices is; separation of Whites and non-Whites.

What is apartheid?

Apartheid, particularly in South Africa was a system of legislation that upheld segregationist policies favouring white but against non-white citizens of South Africa. Racial segregation was the core feature of apartheid, hence, Choice D is correct.

Read more on apartheid;

https://brainly.com/question/1380803

#SPJ1

I want to know about the history of The Sino-Japanese

Answers

Answer:

The Sino-Japanese Sino-Japanese War refers to the War of Japanese aggression against China and Korea at the end of the 19th century. According to the Chinese dry branch chronicle, the year 1894 when the war broke out was the year of Jia Wu, so it was called the Sino-Japanese War. Japan called it the "Sino-Japanese War," the Korean Peninsula called it the "Sino-Japanese War," and the Western countries called it the "First Sino-Japanese War."

Japan in the Meiji Restoration began to embark on the capitalist road, actively invaded and expanded abroad, and established a "mainland policy" centered on China; At this time, the Qing Dynasty was an empire that returned to the light through the foreign affairs movement, with political corruption, the people's life was difficult, the various factions in the official arena were openly fighting and cheating, the national defense and military were strong and strong, and the discipline was lax; The world's major capitalist countries are gradually transitioning to imperialism, and Japan's aggressive acts are supported to a certain extent by the Western powers.

In 1894, the Dongxue Party revolt broke out in Korea, the Korean government army was defeated and retreated, forced to beg for help from the suzerainty of the Qing Dynasty, and Japan also took the opportunity to send troops to Korea to deliberately provoke war.

On July 25, 1894 (the 20th year of Guangxu), the Battle of Toshima broke out, and the Sino-Japanese War began, because Japan had been planning for a long time, and the Qing Dynasty rushed to meet the battle, which ended with the defeat of China and the total destruction of the Beiyang Marine Division. The Qing Dynasty government of China, under the military pressure of Japanese militarism, signed the Treaty of Maguan on April 17, 1895.

Explanation:

What territories would the Byzantine Empire gain and lose again after 330 CE?

A. Thrace and Egypt
B. Britain and Italy
C. Spain, Italy, and North Africa
D. Macedonia and Anatolia

Answers

Answer:

The answer is C. Spain, Italy, and North Africa

Explanation:

From approximately 476 CE - 526 CE, the Byzantine Empire did not have the territories Spain, Italy, or North Africa. This was until approximately 550 CE when the Byzantine Empire gained Italy, North Africa, and part of Spain. This lasted til around 750 CE when the Byzantine Empire lost a great amount of those territories.

This explains how the Byzantine Empire gained and lost again Spain, Italy, and North Africa after 330 CE.

Which group within the United States would most likely have supported the
worldview represented in the diagram?
OA. Suffragists
B. Nativists
OC. Populists
D. Settlers

Answers

The people that would have supported the worldview that we have in this diagram are the settlers

Who were the settlers?

These were the people that were known to moved from the Eastern part of Europe to the Americas in order to settle.

They were the first group that settled in the area before other people started to join them.

Read more on American settlers here:

https://brainly.com/question/588546

#SPJ1

why did jane addams think workers were
the main agitators for reform by the state

Answers

Jane Adams think workers were the main agitators for reform by the state as it was an avenue for a social reform and ensuring equality.

What is social reform?

It should be noted that social reform means a type of social movement that aims to bring a social system closer to the ideal of the community.

In this case, Jane Adams think workers were the main agitators for reform by the state as it was an avenue for a social reform and ensuring equality.

Learn more about social reform on:

brainly.com/question/19570924

#SPJ1

Type the Word
associationism
Definition
Theory that the mind is composed of elements organized by means of association.
Usage
An example of associationism is associating summertime with swimming pools.

Answers

Associationism, in psychology, refers to the phenomenon whereby, the mental state of an individual is resulted from other basic mental states, or feelings, mental events, memories and et cetera.

Associationism is a psychological process where an individual's current mental state is based on the connections it has with previous mental states, or with a stimulus word. For example, when one hears the word 'Spring', one might think of 'blooming flowers'. Similarly, when one thinks of the word 'Exam', one might think of being nervous, or associate it with 'stress' or 'pens' and et cetera. Research in the process of associationism was pioneered by Aristotle. He formulated five basic laws through which associationism occurs, they are:ContiguityRepetitionAttention Pleasure-pain Similarity

From the above, the meaning of Associationism and the examples are clear.

Disclaimer:

Your answer was incomplete. Please check below for the full content.

"What is Associationism? Explain with examples."

Learn more  about Associationism here:

https://brainly.com/question/1068788

#SPJ10

To which duty of a House member does this quote most
likely refer?
• to propose and draft state laws
O to hire and manage staff in Washington D.C.
• to meet with constituents in the district
• to serve on committees in the House

Answers

Answer:

C). To meet with constituents in Washington D.C. and in the district.

Papermaking is one of the four great inventions in China. It was invented in the Western Han Dynasty and improved in the Eastern Han Dynasty. China is the first country in the world to raise silkworms and weave silk. In ancient China, the working people of the ancient times drew silk from silkworm cocoons, and the remaining cocoons and diseased cocoons were made of silk cotton by bleaching. After the drifting is completed, there will be some residue left on the mat. When there are many times of flocculation, the residual flocs on the mat will accumulate into a layer of fibrous flakes, which can be peeled off after drying and can be used for writing. There are not many by-products of this kind of bleaching, and it is called Hejia or Fangxu in ancient books.

Answers

The invention of paper was what brought about printing technology into the world years after this invention.

The history of Paper

Paper is known to have being an invention of the Chinese people. Cai Lui is the Chinese that paper making is attributed to.

The first paper came into existence in the Han dynasty in 105 CE. It was created through the use ofb rags and also materials from plants fibers.

Read more on papermaking here:

https://brainly.com/question/10469404

#SPJ1

what was not true about the economic at the end of world war II


A- the gnp and corporate profits doubled
B-National debt quadrupled during the war
C-Wage freezes reduced consumer spending
D- Efficiencies in farming reduces manual labor needs

Answers

What was not true about the economic at the end of world w.a.r. II is option E. Efficiencies in farming reduces manual labor needs. Read below about the economic state at the end of world w.a.r. II.

What was the state of the economic at the end of world war. II.?

The private economy was a success as the government stopped buying arms. Factories that had once made bombs now made toasters, and toaster sales were on the rise. On paper, measured GDP did drop after the w.a.r.

Therefore, option E. Efficiencies in farming reduces manual labor needs was not true as assorted food even gave in for recruitment of labourers.

learn more about post world war II economy: https://brainly.com/question/2141423

#SPJ1

Why was the Battle of Stalingrad a significant event in World War II?

Answers

The battle forced the Germans to retreat from all of Eastern Europe. The battle stopped the Germans from advancing further east.

What are the different agents that influence political socialization?

Answers

Answer:

The Family, Schools, Mass Media, Peers, Churches and religion, Political Institutions and Leaders.

Explanation:

Answer:

The family, The school, The peer group, and the media

What was the purpose behind the New Deal?

Answers

Answer:

A series of relieve programs.

Explanation:

The New Deal was a series of large-scale relief programs and reforms that FDR implemented to counteract the economic effects of the Great Depression.

The New Deal advocated government spending as a key economic driver boosting consumer demand.

The New Deal played a significant role in countering the Great Depression and revitalizing the U.S. economy.

FDR’s plan revealed just how vital the government’s role is in the management of the nation’s economy.

Why was Edith Cavell used in anti-German
propaganda posters?
She was executed by Germany for treason.
She was a victim in the bombing of the Lusitania.
She developed propaganda against Allied nations.
She was a spy for the German government.

Answers

Edith Cavell was used in anti-German propaganda posters because she was executed by Germany for treason

Why was she used in propaganda posters?

The British decided to use her story which made her be one of the most prominent female casualties of world war 1 because of her gender, nursing profession and her heroic approach to death.

Hence, she was used in anti-German propaganda posters because she was executed by Germany for treason

Therefore, the Option A is correct.

Read more about Edith Cavell

brainly.com/question/9859486

#SPJ1

Answer: A. She was Executed for Treason

Explanation:

She was a propaganda artist who was executed in Germany for her crimes. The Answers also for the Test are
1. C
2. A
3. D
4. B
5. B
6. D
7. A
8. BCD
9. D

10. C

who was a leader of the Soviet Union

Answers

Soviet Union has 2 leader Mikhail Gorbachev took the place in 15 march 1990 and leave in 25 December 1991 he was the leader for 1 year and 285 days and the other one was Gennady Yanayev he took the place in 19 August and left in 21 August he was the leader for 2 days
Joseph Stalin from 1924 to 1953

Which of the following statements is correct?
Select one:
a.The stock market crash of 1929 was the single cause of the Great Depression.
b.During the Great Depression, hundreds of thousands of business went bankrupt, unemployment was high, and many banks collapsed.
c.Herbert Hoover was anxious to give money to the needy people during his presidency.
d.The Great Depression was a time when farming was profitable and unemployment rates were low.

Answers

B. During the Great Depression, hundreds of thousands of business went bankrupt, unemployment was high, and many banks collapsed.

a person with head injury of still suffers from memory loss why​

Answers

Explanation:

People with TBI may not remember the injury itself. In this case, the brain has not stored the injury as a memory or series of memories. People may remain confused and unable to store memories for some time after the injury. The loss of memory from the moment of TBI onward is called post-traumatic amnesia.

According to this cartoon, what group of women opposed the women's
suffrage movement because of prejudice?
OA. The husbands of women suffragists
B. The middle class and the upper class
C. Women suffragists
D. Women antisuffragists

Answers

The people that opposed the women suffrage movement were the  Women antisuffragists.

What was the women's suffrage movement?

This was a movement that occurred due to the fact that women were fighting to be allowed to be a part of the political system of the nation.

The women wanted to have the rights to vote whenever there were elections in the country.

Read more on women suffrage here: https://brainly.com/question/8862360

#SPJ1


What did Jefferson predict would happen as a result of
making compromises on slavery?

Answers

The division over slavery would eventually result in the end of the nation.

Regina has chosen a ringtone for her phone that is called Ode to Joy. This is actually a famous melodic theme. Who composed this famous work?

Tchaikovsky


Liszt


Brahms


Beethoven

Answers

the answer is beet hoven
Other Questions
Which of these will complete the simple sentence?Mee Younga. was a great math student, but she did notenjoy her English classes as muchb. and Henry practiced for their duet for hoursAc. got sick right before the performance;however, she was able to complete her solonone of thesePlease select the best answer from the choices providedBd. none of these If 1 < a x , then the minimum value of [tex] \rm log_{a}(x) + log_{x}(x) [/tex] is ?PLEASE HELP!!!! how to solve superstition In the decade between 1882 and 1892, lynching rose in the South by an overwhelming 200 percent, with more than 241 black people killed. Lynching was used as a means of social control to terrorize and intimidate blacks. Which cultural myth was used to justify and legitimate the practice of white mobs lynching black people Juan is learning about like terms in his math class. He must check all the combinations below that are like terms which ones should he check What is the value of p? essay on depending on other countries very harmful to us James has $1500 to open a checking account. He can maintain a monthly balance of at least $1000. He plans to use the ATM four times per month at his local branch. He does not overdraft his account and plans to use direct deposit. He also plans to pay his bills online and he averages 8 bills per month. Bank Account Terms and Conditions James wants an account with the lowest fees. Which checking account would be best for James A recent order for 15,000 items of building supplies was composed of bolts and nails. Nails cost 5 cents each. The entire order arrived at an expense of 1500 dollars. If there were 2500 bolts, what is the cost of each bolt? Which factor contributed to European global exploration during the 15th to18th centuries? D 37 = 40D = Check your solution. 37 = 40 The boys (clean) the car. It looks new again. Problem 4 (a) three friends are packing sweets into gift boxes. they agree that each box should contain the same number of sweets, but they are each working in separate locations with their own pile of sweets so cannot share boxes. gwen has 286 sweets, bill has 390 sweets and zeta has 468 sweets. if they put the largest number of sweets into each box that they can and they use up all their sweets, how many boxes of sweets will they pack? (b) use the euclidean algorithm to find the highest common factor of 8008 and 24255 (you need to show all working). Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom why Germany was fertile soil for the Nazis following World War I? To learn by rote and imitation signifies: Group of answer choices Precomposed tradition Absolute Tradition Oral tradition Programmatic tradition three interior angles of a quadrilateral measure 55 , 117 , and 120. what is the measure of the fourth interior angle? Write a system of equations that could be used to solve the situation described below.You find 12 coins under the couch. Every coin is either a nickel or a penny, and they add up to a total of 32 cents. How many of each type of coin do you have? Let x represent the number of pennies and y represent the number of nickels.Please select the best answer from the choices providedA. x+y=12 0.05x+0.01y=0.32B. x+y=0.32 0.01x+0.05y=12C. x+y=12 0.01x+0.05y=0.32D. not enough information my guy friend is asking me if he dated a they/them, would that make him g.ay? If you was a trans male, I didn't know the answer and my friends were ghosting me, can anyone help? Rewrite the following expression X 9/7