a client presents in the emergency department with acute onset of fever, headache, stiff neck, nausea/vomiting, and mental status changes. what interventions should the nurse initiate

Answers

Answer 1

The interventions should the nurse initiate are

1. Elevate HOB 30 degrees

2. Pad side rails

3. Provide sponge bath if temperature greater than 101°F (38.3°C)

4. Darken room

What is bacterial meningitis?Bacterial meningitis is brought on by bacteria that enter the bloodstream, travel to the brain, and affect the spinal cord. A direct bacterial invasion of the meninges, however, can also result in bacterial meningitis. An ear infection, sinus infection, a skull fracture, or — very infrequently — certain operations could be the culprits. 1., 2., 3. & 5. Correct: Meningitis caused by bacteria is associated with sudden onset of fever, headache, stiff neck, n/v, and changes in mental state. To improve comfort and lower intracranial pressure, elevate the head of the bed. The nurse should take seizure precautions, which include padding the side rails, because the client is at a higher risk for seizures. If your fever is higher than 101°F (38.3°C), you should take a sponge bath as an independent nursing intervention.

To learn more about bacterial meningitis refer to:

https://brainly.com/question/11061951

#SPJ4

Related Questions

children of alcoholics . a. have a greater risk of being alcoholics b. are more likely to resist alcohol c. are less likely to develop health problems associated with alcohol consumption d. are more likely to be binge drinkers

Answers

Children of alcoholics are more likely to be binge drinkers.

The majority of people who abuse alcohol and develop alcohol use disorders are in their early to mid-20s. Someone is more likely to become an alcoholic later in life the younger they start drinking. This is especially accurate for those who begin drinking before the age of 15.

It may have an impact on how the brain, liver, bones, and hormone production develop normally. Before the age of 14, drinking is linked to higher health risks, including accidents involving alcohol, engagement in crime, and attempts.

By reducing dietary caloric intake, hindering nutrient absorption and digestion decreasing peptide synthesis and secretion, boosting metabolism of gut proteins, and boosting the breakdown and excretion of nutrients, both acute or persistent alcohol consumption can lead to malnutrition.

Learn more about alcoholics here:

https://brainly.com/question/28448244

#SPJ4

which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge?

Answers

Examine her nursing methods to find any potential issues. To continue at home, the youngster is given samples of no-salt-added diets.

What is a glomerulonephritis?The small filters in your kidneys are harmed by glomerulonephritis (the glomeruli). Immune system attacks on healthy body tissue are a common cause of it. The typical symptoms of glomerulonephritis are nonexistent. Blood or urine tests that are performed for another purpose increase the likelihood of a diagnosis.After recovering from a strep throat infection or, less frequently, a skin infection brought on by the streptococcal bacterium, glomerulonephritis may appear a week or two later (impetigo). The glomeruli become inflamed as a result of an accumulation of antibodies to the microorganisms. Symptoms of kidney failure, such as edema (typically in the legs), high blood pressure, and decreased urine production, can appear in very severe instances of glomerulonephritis.

To learn more about glomerulonephritis refer to:

https://brainly.com/question/14010232

#SPJ4

a client may be developing side effects from an anticholinergic medication. which question does the nurse ask the client to further assess for side effects to this medication? (select all that apply.)

Answers

Constipation, nausea, difficulties emptying the bladder, reduced perspiration, dry mouth, blurred vision, and rapid heartbeat are among the most frequent side effects of anticholinergics.

What is an anticholinergic drug's side effect? Constipation, nausea, difficulties emptying the bladder, reduced perspiration, dry mouth, blurred vision, and rapid heartbeat are among the most frequent side effects of anticholinergics.Adults over the age of sixty-five and others who have trouble thinking properly may find other side effects particularly annoying. The nurse prioritizes planned interventions, evaluates patient safety while conducting interventions, delegate actions as necessary, and document interventions carried out throughout the implementation phase of the nursing process.3A placebo effect may be more likely to occur in those who are highly motivated and anticipate the treatment to be effective.Even how a patient reacts might be influenced by the prescribing doctor's enthusiasm for the course of therapy.These parallels serve to illustrate bioequivalence, which states that a generic drug functions similarly to a brand-name drug and has a comparable clinical benefit.In other words, you can take a generic medication in place of a brand-name medication.

To learn more about anticholinergic drug's refer

https://brainly.com/question/14311524

#SPJ4

a concerned mother of a newborn with a cleft lip asks the nurse when the surgical repair will occur. which is an appropriate nursing response?

Answers

The nurse response will be that surgical repair is normally done between the ages of 6 and 12 weeks.

Surgery is a medical specialty that employs operative manual or instrumental procedures on a person in order to examine or treat a pathological condition like a illness or injury, to assist enhance body function or appearance, or to repair undesirable ruptured regions.

The surgical procedure, operation, and simply "surgery" refers to the act of doing surgery. The surgeon, a surgeon's assistant, an anaesthetic, a circulating nurse, and a surgical technician comprise a surgical team. Surgery normally lasts from minutes to hours, although it is not a continuous or recurring therapy. Arthroplasty is still a surgical treatment that restores joint function. Resurfacing the bones can rehabilitate a joint. A prosthesis may also be utilised. Different forms of arthritis can affect the joints.

To know more about the Surgical operations, here

https://brainly.com/question/1827992

#SPJ4

the nurse is reading the primary health care provider's (phcp) documentation regarding a pregnant client and notes that the phcp has documented that the client has an android pelvic shape. the nurse understands that which characteristics are included with this pelvic shape? select all that apply

Answers

Android shaped pelvis has triangular or heart-shaped inlet and is narrower from the front.

What is the shape of Android pelvis?

It is rather small in front and has a heart-shaped brim. This form of pelvis is common in African women as well as tall ladies with narrow hips. The pelvic exit and cavity are frequently long, thin, and straight. Ischial spines are clearly visible.

It has a nearly round brim and, under normal conditions, will allow the passage of an average-sized infant with the least amount of stress to the mother and baby.

The pelvic cavity (the interior of the pelvis) is typically small, has straight side walls, and doesn't have particularly noticeable ischial spines that could provide an issue for the baby when it passes through. Babies born to women with this pelvic structure may rest their backs against their moms.

To learn more about Android pelvis refer to:

https://brainly.com/question/16149571

#SPJ4

if you are eating at a restaurant, how can you increase the likelihood that the restaurant meal meets your nutrient needs and supports health?

Answers

You may boost the possibility that the restaurant meal satisfies your nutrient needs and promotes health by requesting that any leftovers be placed in take-out containers as soon as possible.

It is important to have a well-balanced diet. While each of the individual nutrients discussed above are important, it is important that a person take in a combination of all of them to make a well-balanced diet. Together they work to keep the body working at its optimum (best) level. The Care Plan will instruct an HHA/PCA on the patient's nutritional needs and limits. Home Health Aides/Personal Care Aides must always adhere to these guidelines because they are in place to best support the patient's health.

If they are unsure if a patient can consume a certain food, then should consult with their supervisor. It is essential to have a well-balanced diet. Although each of the individual nutrients listed above are vital, it is necessary that a person take in such a combination of all of them to build a well-balanced diet. They collaborate to maintain the body functioning at its peak (best).

To know more about the Balanced diet, here

https://brainly.com/question/30206449

#SPJ4

a patient who has acute pancreatitis is prescribed famotidine. the nurse explains that this drug is given for which purpose?

Answers

The function of giving a patient with acute pancreatitis is to reduce stomach acid production.

What is corelation between pancreatitis with stomach acid?

Pancreatitis is an inflammation of the organ lying located behind the lower part of the stomach which is called pancreas.

Pancreatitis could come suddenly and last for days or it may occur over many years. Previous studies prove that anti-acid therapy with proton pump inhibitors can reduce pancreatic secretion and it can be used on treating acute pancreatitis. The common cause of pancreatitis to occur are gallstones that block enzyme regulation in the pancreas.

Learn more about pancreatitis here

https://brainly.com/question/29097123

#SPJ4

the nurse observes a wrench taped to the head of the bed of a client who is currently in surgery. which device does the nurse expect this client to have when returning to the care area?

Answers

The device Apathy or an unwillingness to wake up, a headache that worsens and does not go away.

Which finding is indicative of a basal skull fracture?Several clinical indicators that are strongly suggestive of a basilar skull fracture include: Hemotympanum, Blood will collect behind the tympanic membrane in the event of fractures involving the petrous ridge of the temporal bone, turning it purple.Apathy or an unwillingness to wake up, a headache that worsens and does not go away.Apathy or an unwillingness to wake up, a headache that worsens and does not go away. Speech slurs, numbness, or lack of coordination. nausea or vomiting that occurs frequently, convulsions, or seizures (shaking or twitching).Apathy or an unwillingness to wake up, a headache that worsens and does not go away. Speech slurs, numbness, or lack of coordination. nausea or vomiting that occurs frequently, convulsions, or seizures (shaking or twitching).

To learn more about Skull fracture refer to:

https://brainly.com/question/27961333

#SPJ4

the obstetric nurse explains to the client that when she stops breast-feeding, her breast tissue will reduce in size. the nurse understands that this regression is due to which physiologic process?

Answers

Your milk ducts stop producing milk when you have finished weaning from nursing.The amount of breast tissue may decrease as a result.

What transpires to your breasts if you stop nursing? Your milk ducts stop producing milk when you have finished weaning from nursing.The amount of breast tissue may decrease as a result.Your skin may occasionally tighten to accommodate your larger breast size, but there may also be instances when it lacks the suppleness to do so.Your breasts will likely start to shrink once your kid starts eating solid meals, which is often around the 6-month mark but can happen earlier.They should regain their pre-pregnancy size or something similar after weaning.When you quit breastfeeding, your breasts will progressively get smaller as the milk-producing cells in them start to shrivel.At this point, some women claim their breasts feel or appear empty.After some time, fat cells will start to replace milk-producing cells once more, and you might notice that your breasts start to regain some fullness.

To learn more about breast-feeding refer

https://brainly.com/question/18359673

#SPJ4

Other Questions

A group of researchers investigated the effect of media usage (whether or not subjects watch television or use the Internet) in the bedroom on ""Tiredness"" during the day (measured on a 50 point scale a. Identify each of the variables, state whether the variables are quantitative or categorical, and identify each variable as either explanatory or response variables. nterviewed b. To collect these data, the researchers randomly selected homes to visit and i the adult member of the household whose birthday was nearest. Is this an experiment or an observational study? Briefly explain. When a consumer has evaluated alternatives in the purchase decision process and selected one, he still must determine from whom he will buy andO level of involvementO increasesO when to buyO countertrade assume you have found a usb memory stick in your work parking area. what threats might this pose to your work computer should you just plug the memory stick in and examine its content? in particular, consider whether each of the malware propagation mechanisms we discuss could use such a memory stick for transport. what steps could you take to mitigate these threats, and safely determine the contents of the memory stick? Match the correct numbers and letters together please. given that a 300-k blackbody radiates its peak energy at a wavelength of about 10 mm, at what wavelength would a 600-k blackbody radiate its peak energy? b. if the two bodies in part (a) were the same size, what would be the ratio of the heat emitted by the hotter object to the heat emitted by the colder one glucose and ? are the product of photosynthesis . which of the changes would keep then hanger in balance? select all that apply aamc 2022 free practice exam bbquestion a particular diploid organism is heterozygous in each of 3 unlinked genes. considering only these 3 genes, how many different types of gametes can this organism produce? Ah, happy, happy boughs! that cannot shed Your leaves, nor ever bid the Spring adieu; And, happy melodist, unwearied, For ever piping songs for ever new Write two to four sentences comparing the themes of the two poems. Use evidence from the texts to support your answer. The Cold War 4. Why is this sporting event (in the light of the Cold War conflict)? 8.why is it impossible for bruno to understand what is going on around him, even when shmuel tries to explain it to him? 30 POINTS ASAP America at the Turn of the Centuryadapted from the Library of Congress By 1900 the American nation had established itself as a world power. The West was won. The frontier was no more. The continent was settled from coast to coast. Apache war chief Geronimo had surrendered in 1886. Defeat of the Sioux at the battle of Wounded Knee in 1891 had brought the Indian Wars to a close. By 1900 American Indians were on reservations and the buffalo were gone. Homesteading and the introduction of barbed wire in 1874 had brought an end to the open range. The McCormick reaper had made large-scale farming profitable. In 1900, the U.S. was by far the world's largest agricultural producer. The first transcontinental rail link had been completed in 1869. Three decades later, in 1900, the nation had 193,000 miles of track, with five railroad systems spanning the continent. The world's first oil well had been drilled in Titusville, Pennsylvania, in 1859. By 1900, major oil fields were being tapped in Kansas, Illinois, Louisiana, Oklahoma, and Texas. The supply of American oil seemed limitless. John D. Rockefeller's Standard Oil Trust dominated the world's petroleum markets. It controlled more than 90 percent of the nation's refinery capacity. At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced. In the 1880s Andrew Carnegie had constructed the world's largest steel mill in Pittsburgh, Pennsylvania. By 1900, the United States was the largest steel producer in the world, turning out 10,000,000 tons a year. Henry Ford had built his first gasoline engine car in 1892 and the world's first auto race was held in Chicago in 1896. With the founding of the Ford Motor Company in 1903, the age of the automobile was underway. By 1900, telephones were in wide use. Cities were being electrified. Moving pictures were a curiosity. Guglielmo Marconi was conducting experiments that would lead to the development of the radio, and the Wright brothers were at work on a heavier-than-air flying machine. Cities were growing. New wealth and devastating fires produced a boom in urban construction. Architects Richardson, Hunt, McKim, Mead, and White flourished. Sullivan pioneered the skyscraper and his protg, Frank Lloyd Wright, was beginning his career in Chicago. This was a time of both confidence and ferment. In the cities and the states, political "Progressives" were coming to power, experimenting with reforms such as women's suffrage, direct election of United States senators, the initiative, recall, the Australian ballot, primary elections, and laws setting minimum wages, work standards, and regulated rates for common carriers and services. Followers of the Progressive movement believed in the perfectibility of man and his society. Republican William McKinley of Ohio was elected president in 1896 and re-elected in 1900. He had been preceded by Democrat Grover Cleveland. McKinley looked every inch a president. Young reporter William Allen White said of him after an interview: "He was the statue in the park speaking." A dignified, reserved man, McKinley was the last of the old-style, low-key presidents. McKinley was the last of five Civil War veterans to serve in the White House, signaling the end of the post-war era. He was also the fifth of the six Ohio presidents to serve during the fifty-year period 1868-1908. McKinley is generally considered to have been a good but weak man. He would be followedand overshadowedby Theodore ("Teddy") Roosevelt, who was vice-president when McKinley was assassinated in 1901. Later, Roosevelt would be elected president in his own right. The ascendancy of Ohio and the Midwest in national politics demonstrated that the United States was no longer a nation oriented to the Atlantic seaboard. It stretched, as the anthem, America the Beautiful, put it, "from sea to shining sea."Select all the correct answers.Read the sentence from "America at the Turn of the Century."At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced.Which three sentences correctly paraphrase the sentence?A. A nation's industry was considered powerful by the number of tons of steel it produced (Library of Congress). B. In the late 19th century, it was the amount of steel produced that showed how powerful a nation's industry was (Library of Congress). C. A nation's industry was considered powerful only if it managed to produce a large quantity of steel (Library of Congress). D. At the turn of the century, the number of tons of steel helped determine the strength of a nation (Library of Congress). E. The quantity of steel produced helped determine the strength of a national industry (Library of Congress). which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge? ache mothers, in paraquay, carry their young children almost all the time to protect them from getting hurt in the forest. consequently, their children walk almost a year later than american children. based on this example, do you think it is the impact of nature, nurture, both or neither that influenced this cultural difference? You develop and deploy several microservices to an Azure Kubernetes Service (AKS) cluster. The microservices are instrumented with the Application Insights SDK. You configure an Application Insights instance and use the connection string in the instrumentation.The instrumentation includes a custom telemetry value used to track the order checkout action. Order checkout is an action that includes a property to capture the order number.You need to capture the custom order telemetry.Which Application Insights data type should you use?Select only one answer.tracedependencymetricevent Otis wants to borrow 10000 to buy a used car. he examined his budget and decided that he can afford a payment of $200 a month. if his bank offers him a rate of 7.5%, how long should he borrow the money so he can afford his monthly payment? two harmonic waves are described by y1= (4m) sin (8/mx-300/s t) y2=(4m) sin (8/mx-300/s t-2) what is the wavelength of the resultant wave ? Below you will find the yearly average values of the Dow Jones Industrial Average, the most popular index of stock market prices, for five different years. The Consumer Price Index for each year (on a base of 1982- 1984 = 100) can be found on the inside back cover of this book. Use these numbers to deflate all five stock market values. Do real stock prices always rise every decade?Year Dow Jomes Industrial Average1970 7531980 8911990 2,8792000 10,7352010 10,663 DXL Practice with algebrai XDL | Identify equivalent in X Q Algebra It A Common Cor X DAt the start of the softball x GIdentify equivalent linear Xbd.com/math/grade-7/identify-equivalent-linear-expressions-word-problems?signinRedirect=https%3A%2F%2Fwww.ixl.com%2Fsignin%2 R.23 Identify equivalent linear expressions: word problems KWH>120xx + 1.2xSubmitAlec's parents give him x dollars per month for his allowance. However, since his birthday isin February, he gets an extra 20% bonus that month.Pick all the expressions that represent how much Alec's allowance is in February.x + 0.2x+1.2x*DX Consider the deflection (based on choices of E and I) and the weight of the material. How would you find a balance between the needed structural performance and weight?