Answer:
6.60mg N / mL
Explanation:
All nitrogen is converted in NH₃ that react with the HCl, thus:
NH₃ + HCl → NH₄⁺ + Cl⁻
In the problem, the excess of HCl reacts with NaOH, thus:
HCl + NaOH → NaCl + H₂O
The moles of NaOH = Moles of HCl in excess is:
4.16mL = 4.16x10⁻³L * (0.0155mol / L) = 6.448x10⁻⁵mol HCl in excess
Initial moles of HCl are:
10x10⁻³L * (0.0390mol / L) = 3.9x10⁻⁴moles HCl
That means the moles of HCl that reacts = Moles of NH3 = Moles of N are:
3.9x10⁻⁴ moles - 6.448x10⁻⁵moles = 3.2552x10⁻⁴ moles N.
To convert these moles to grams we need to use molar mass of N = 14.01g/mol:
3.2552x10⁻⁴ moles N * (14.01g/mol) = 4.56x10⁻³g * (1000mg / g) =
4.56mg of N
And volume in mL is:
691 μL * (1mL / 1000μL) = 0.691mL
Concentration in milligrams per mililiter is:
4.56mg N / 0.691mL =
6.60mg N / mLThe storage method used for radioactive wastes generated from fission nuclear reactors must be designed to last for how long?
months
years
centuries
weeks
Answer: c
Explanation:
Answer: C - Centuries
Explanation:
A nearby pond has what appears to be steam coming off of it after a cold front passes through. What is it?
a. evaporation
b. sublimation
c. vaporization
d. condensation
Answer:
a. evaporation .
Explanation:
In this case, given the described situation, we should take into account that there are two types of liquid-gas phase transitions, evaporation and vaporization, which occur in totally different way.
Firstly, evaporation is a superficial phenomena, it means that it occurs at the surface of the liquid only whereas the vaporization is a bulk phenomena, which means that it occurs along the whole volume of liquid.
In such a way, we can infer that cold steam stream flowing over the pond has the capacity to strip or remove liquid water molecules in the pond and take them to the vapor phase, which means that the answer is a. evaporation .
Best regards.
Which characteristic describes bases?
taste sour
feel slippery
react with metals
are used to remove rust
Answer:
feel slippery
Explanation:
Bases are certain metallic oxides, metallic hydroxides and aqueous ammonia. They typically have the following characteristics;
The aqueous solution of many of them have a bitter taste. The aqueous solutions of bases have soapy or slippery feel and the strong bases are very caustic to the skin. Their aqueous solutions have a pH greater than 7. Bases have the ability to change the color of indicators. They are conduct electricity and are said to be electrolytes.From the choices given, the fitting answer is that bases have a slippery feel.
Answer:
B) Feel slippery
Explanation:
Just did the assignment
What element has an atomic mass 4?
Answer:
Helium has atomic mass 4.002602.
So the answer to yr question is helium.
0
Chem
Equations
Balance and Classify each of the following equations into:
Combination reaction, Decomposition Reaction, Single
Replacement reaction, Combustion reaction Double
Replacement reaction
A)
KBr(aq) + Cl2(g) → _ KCl(aq) + Br2(1)
B)
CaBr2(aq)
+ H2SO4(aq) - CaSO4(s) +_HBr(g)
N2(g) + H2(g) + NH3(g)
Grading: Each Equation Balanced --2 points, Classification --
1 point each
Ontime submission ---1 point
DUE: Oct 9, 2020 at 11:00 AM
Answer :
(A) The balanced chemical reaction will be:
[tex]2KBr(aq)+Cl_2(g)\rightarrow 2KCl(aq)+Br_2(l)[/tex]
This reaction is a single replacement reaction.
(B) The balanced chemical reaction will be:
This reaction is a double displacement reaction.
(C) The balanced chemical reaction will be:
[tex]N_2(g)+3H_2(g)\rightarrow 2NH_3(g)[/tex]
This reaction is a combination reaction.
Explanation :
Balanced chemical reaction : It is defined as the reaction in which the number of atoms of an element present on reactant side must be equal to the product side.
Part (A):
The balanced chemical reaction will be:
[tex]2KBr(aq)+Cl_2(g)\rightarrow 2KCl(aq)+Br_2(l)[/tex]
This reaction is a single replacement reaction in which the most reactive element displaces the least reactive element from its solution.
Part (B):
The balanced chemical reaction will be:
[tex]CaBr_2(aq) +H_2SO_4(aq)\rightarrow CaSO_4(s)+2HBr(g)[/tex]
This reaction is a double displacement reaction in which a positive cation and a negative anion of two reactants exchange their places to form two new products.
Part (C):
The balanced chemical reaction will be:
[tex]N_2(g)+3H_2(g)\rightarrow 2NH_3(g)[/tex]
This reaction is a combination reaction in which the two atoms combine to form a larger molecule.
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first
Answer:
Follows are the solution to this question:
Explanation:
The creation of four fragments,
(n endpoint) MNQSYGR (c endpoint)
Weight of the molecular = 854.92
Load = 2
[tex]\to \frac{mass}{Load}[/tex] = 427.46
(n endpoint)RLVSR (c endpoint)
Weight of the molecular = 629.76
Load = 3
[tex]\to \frac{mass}{Load}[/tex]= 209.92
(n endpoint) AATAMASLIK (c endpoint)
Weight of the molecular = 976.20
Load at pH(2). = 2
[tex]\to \frac{mass}{Load}[/tex]= 442.50
(n endpoint) IFAWWY (c endpoint)
Weight of the molecular = 885.03
Load= 1
[tex]\to \frac{mass}{Load}[/tex]= 885.03
It is apparent that RLVSR is the smallest mass ration for this peptide that is detected in the first place.
an unknown solution gives a yellow-green flame test
Answer:
Barium
Explanation:
In a saturated solution that is in contact with solid Mg(OH)2, the concentration of Mg2 is 1.31 X 10-4M. What is the solubility product for Mg(OH)2
Answer:
Ksp = 8.99x10⁻¹²
Explanation:
The solubility of Mg(OH)₂ is described with the reaction:
Mg(OH)₂(s) → Mg²⁺(aq) + 2OH⁻(aq)
The solubility product, Ksp, is:
Ksp = [Mg²⁺] [OH⁻]²
As you can see from the reaction, when 1 mole of Mg²⁺ is produced, 2 moles of OH⁻ are produced too, if [Mg²⁺] is 1.31x10⁻⁴M, [OH⁻] = 2.62x10⁻⁴M
Replacing:
Ksp = [Mg²⁺] [OH⁻]²
Ksp = [1.31x10⁻⁴M] [2.62x10⁻⁴M]²
Ksp = 8.99x10⁻¹²The solubility product of the [tex]\rm Mg(OH)_2[/tex] has been [tex]\rm 8.99\;\times\;10^{-12}[/tex].
The balanced equation for the dissociation of Magnesium hydroxide has been:
[tex]\rm Mg(OH)_2\;\rightarrow\;Mg^2^+\;+\;2\;OH^-[/tex]
From the balanced chemical equation, dissociation of 1 mole magnesium hydroxide has been resulted in the 1 mole magnesium and 2 mole hydroxide ions.
Since, given magnesium concentration, [tex]\rm Mg^2^+=1.31\;\times\;10^-^4\;M[/tex]
The concentration of hydroxide ion, [tex]\rm OH^-[/tex] will be:
[tex]\rm 1\;M\;Mg^2^+=2\;M\;OH^-\\1.31\;\times\;10^-^4\;M=1.31\;\times\;10^-^4\;\times\;2\;M\;OH^-\\1.31\;\times\;10^-^4\;M=2.62\;\times\;2\;M\;OH^-\\[/tex]
The solubility product (ksp) of the reaction has been given as:
[tex]ksp=\rm [Mg^2^+]\;[OH^-]^2[/tex]
Substituting the values for ksp:
[tex]ksp\;=\rm [1.31\;\times\;10^-^4]\;[2.62\;\times\;10^-^4]^2\\\textit ksp=8.99\;\times\;10^-^1^2[/tex]
The solubility product of the reaction has been [tex]\rm 8.99\;\times\;10^{-12}[/tex].
For more information about solubility product, refer to the link:
https://brainly.com/question/1163248
Why are mass and weight different measurements?
Explanation:
Mass, is amout of matter contained in body
it value remain constant
it cannot be zero
weight is gravitational force which attract body towards centre of earth
it value changes
it can be zero
Helppppp pleaseee fasst What branch of mathematics' principles were the Islamic artists apparently using?
a. Calculus
C. Trigonometry
b. Quasicrystalline geometry
d. Algebra
Please select the best answer from the choices provided
Answer:
its b.
Explanation:
1. Calculate the number of grams of solute required for the preparation of 1.5L of 0.32M NaHCO3 (MW=84)
V1 X C1 = V2 X C2
Answer:
40.32 grams of solute required for the preparation of 1.5L of 0.32M NaHCO₃
Explanation:
Molar concentration or molarity is a measure of the concentration of a solute in a solution. Molarity is defined as the number of moles of solute present in one liter of solution.
Molarity is calculated by the expression:
[tex]Molarity=\frac{number of moles of solute}{volume}[/tex]
Molarity is expressed in units [tex]\frac{moles}{liter}[/tex].
In this case:
Molarity: 0.32 Mnumber of moles of solute: ?volume: 1.5 LReplacing:
[tex]0.32 M=\frac{number of moles of solute}{1.5 L}[/tex]
Solving:
number of moles of solute= 0.32 M* 1.5 L
number of moles of solute= 0.48 moles
Being the molar weight of NaHCO₃ equal to 84 g / mole, the following rule of three can be applied: if there are 84 grams in 1 mole, how much mass is there in 0.48 moles?
[tex]mass=\frac{0.48 moles*84 grams}{1 mole}[/tex]
mass= 40.32 grams
40.32 grams of solute required for the preparation of 1.5L of 0.32M NaHCO₃
Fluorescent light bulbs, or CFLs, prevent the loss of energy from light bulbs as ________ energy.
A. Light
B. Electrical
C. Chemical
D. Thermal
Please do mark me as Brainiest. I would be so happy!!! Here's your answer....
Answer:
D.)
Explanation:
Compact fluorescent lamps, or CFLs, use 75 percent less energy than a traditional incandescent bulb, but they never quite caught on for home use.
Have a great rest of your day!
6th grade help me plzzzzzz
Answer:
It's protons and neutronsExplanation:
Hope this helpspls help me with this!!
Answer:
B. 65
Explanation:
arrange your numbers as:
63,64,66,69
add 64 and 66 together to get 130 then divide by 2
-or just think about what number is between 64 and 66
why do we study properties of matter
Answer:
The properties of matter include any traits that can be measured, such as an object's density, color, mass, volume, length, malleability, melting point, hardness, odor, temperature, and more. We need to study all these traits since every single object around us, including us, is made of matter. Without matter we wouldn't exist; it would be infinite darkness everywhere.
True or False – When earthquakes occur, they form huge gaps in the earth’s surface.
Answer:
i think the answer is true pls mark branliest
Explanation:
Answer:
its true! earth quakes do form huge gaps in the earth surface
Explanation:
Liquid hexane reacts with gaseous oxygen gas to produce gaseous carbon dioxide and gaseous water . What is the theoretical yield of water formed from the reaction of of hexane and of oxygen gas
Answer:
[tex]m_{H_2O}=6.84gH_2O[/tex]
Explanation:
Hello.
In this case, for 5.17 g of hexane (molar mass = 86 g/mol) and 16.5 g of oxygen (molar mass =32 g/mol), we have the reaction:
[tex]C_6H_{14}+\frac{19}{2} O_2\rightarrow 6CO_2+7H_2O[/tex]
Next, via the 1:7 mole ratio of hexane to carbon dioxide and 19/2:7 mole ratio of oxygen to carbon dioxide, we compute the yielded mass of water (molar mass = 18 g/mol) as its theoretical yield by the two masses of reactants and we infer that the limiting reactant is that yielding the fewest moles of product:
[tex]m_{H_2O}^{by\ Hexane}=5.17gC_6H_{12}*\frac{1molC_6H_{12}}{86 gC_6H_{12}} *\frac{7molH_2O}{1molC_6H_{12}}*\frac{18gH_2O}{1molH_2O} =7.57gH_2O\\\\m_{H_2O}^{by\ Oxygen}=16.5gO_2*\frac{1molO_2}{32gO_2} *\frac{7molH_2O}{\frac{19}{2}molO_2 }*\frac{18gH_2O}{1molH_2O} =6.84gH_2O[/tex]
Whereas it is evidenced that oxygen yields the fewest grams of water, therefore, it is the limiting reactant and the theoretical yield of water is:
[tex]m_{H_2O}=6.84gH_2O[/tex]
Best regards!
Please help!!!!!!!!!!!
Answer:
They both have two valence electrons
Answer:
I am guessing because they are both metals
To make a ball move faster, you need to increase
The force applied to the ball
The size of the ball
O The mass of the ball
The friction under the ball
Answer:
The force applied to the ball.
Explanation:
Hope this helps!! Good luck!!
Question 1 (5 points)
Calculate the frequency of a photon that exhibits a wavelength of 451 nm.
Equation: E = hu
h = 6.63 x 10-34]'s
Answer:
e
Explanation:
Which of the following can be broken down by chemical processes but not physical processes?
elements
compounds
all of these
mixtures
Answer:
Elements and compounds
Explanation:
Elements and compounds, mixtures are not chemically bonded and can be physically seperated
Which statement best describes how an ionic bond forms?
What is the Theoretical yeild of CaCO3 from 2 g of CaCl2 and 2.5 g of K2CO3
Answer:
Theoretical yield of CaCO₃ is 2.002 g.
Explanation:
Given data:
Mass of K₂CO₃ = 2.5 g
Mass of CaCl₂ = 2 g
Theoretical yield of CaCO₃ = ?
Solution:
Chemical equation:
K₂CO₃ + CaCl₂ → CaCO₃ + 2KCl
Number of moles of K₂CO₃:
Number of moles = mass/molar mass
Number of moles = 2.5 g/ 138.205 g/mol
Number of moles = 0.02 mol
Number of moles of CaCl₂:
Number of moles = mass/molar mass
Number of moles = 2 g/ 110.98 g/mol
Number of moles = 0.02 mol
Now we will compare the moles of CaCO₃ with K₂CO₃ and CaCl₂.
CaCl₂ : CaCO₃
1 : 1
0.02 : 0.02
K₂CO₃ : CaCO₃
1 : 1
0.02 : 0.02
Theoretical yield of CaCO₃:
Mass = number of moles × molar mass
Mass = 0.02 mol × 100.1 g/mol
Mass = 2.002 g
Theoretical yield of CaCO₃ is 2.002 g.
BRAINLIEST!!!!!!!!!!
Lard, Lye, and Salt are combined to make Glycerin (a sweet-tasting substance found in lotion) and Soap. This process makes some left-over material as a waste product. If 30.0 kg of lard, 20.0 kg of lye, and 5.0 kg of salt are combined and 25.0 kg of glycerin and 5.0 kg of waste are produced, what mass of soap is made? Show all work.
Explain how question demonstrates the Law of Conservation of Mass.
Answer:
30
Explanation:
25.0 + 5.0 = 30
Answer:
30
Explanation:
2.56 g of hydrogen reacts completely with 20.32 g of oxygen
to form X g of water. X = g
Answer:
Mass of water produced is 22.86 g.
Explanation:
Given data:
Mass of hydrogen = 2.56 g
Mass of oxygen = 20.32 g
Mass of water = ?
Solution:
Chemical equation:
2H₂ + O₂ → 2H₂O
Number of moles of oxygen:
Number of moles = mass/ molar mass
Number of moles = 20.32 g/ 32 g/mol
Number of moles = 0.635 mol
Number of moles of hydrogen:
Number of moles = mass/ molar mass
Number of moles = 2.56 g/ 2 g/mol
Number of moles = 1.28 mol
Now we will compare the moles of water with oxygen and hydrogen.
O₂ : H₂O
1 : 2
0.635 ; 2×0.635 = 1.27
H₂ : H₂O
2 : 2
1.28 : 1.28
The number of moles of water produced by oxygen are less thus it will be limiting reactant.
Mass of water produced:
Mass = number of moles × molar mass
Mass = 1.27 × 18 g/mol
Mass = 22.86 g
Answer:
22.88
Explanation:
correct have a g'day mate
The bitter-tasting compound quinine is a component of tonic water and is used as a protection against malaria. It contains only C, H, N and O. When a sample of mass 0.487 g was burned, 1.321 g of carbon dioxide, 0.325 g of water, and 0.0421 g of nitrogen were produced. The molar mass of quinine is 324 g/mol. Determine the empirical and molecular formulas of quinine. (Type your answer using the format CO2 for CO2 and use the order CHNO)
empirical
........
molecular
..........
Answer:
Empirical formula = [tex]\mathbf{C_{10}H_{12}N_{2}}[/tex]
Molecular formula = [tex]\mathbf{C_{20}H_{24}N_{4}}[/tex]
Explanation:
From the given information:
we need to estimate the mass of carbon C in 1.321 g of [tex]CO_2[/tex]
before that, the number of moles of C is:
[tex]C = 1.321 \ g \times \dfrac{1 \ mol \ CO_2}{44/010 \ g \ of \ CO_2}[/tex]
c = 0.03002 mol
we know that:
number of moles = mass/ molar mass
mass = number of moles × molar mass
mass = 0.03002 × 12.011g of C
mass of C = 0.3606 g
Similarly; for hydrogen
the number of moles of H = [tex]0.325 g \ of \ H_2O \times \dfrac{ 1\ mol \ H_2O}{18.02g \ of \ H_2O}\times \dfrac{2 \ mole \ of H }{1 \ mol \ H_2O }[/tex]
the number of moles of H = [tex]0.325 g \ of \ H_2O \times \dfrac{2 \ mole \ of H}{18.02g \ of \ H_2O}[/tex]
the number of moles of H = 0.0361 mol of H
mass of H = [tex]0.0361 \ mol \ of \ H \times \dfrac{1.008 g \ of \ H}{ 1 \ mol \ of \ H}[/tex]
mass of H = 0.0364 g
The mass of N will therefore be the difference the sample burnt with the mass of carbon and hydrogen.
i.e
mass of N = 0.487 g - 0.3606 of C - 0.0364 g of H
mass of N = 0.0900 g
however, the number of moles of nitrogen = mass/ molar mass
the number of moles = 0.0900 g /14.007 g
the number of moles of nitrogen = 0.00643 mol
Thus, the formula is: [tex]\mathsf{C_{0.03002}H_{0.0361}N_{0.00643}}[/tex]
If we divide by the smallest number (0.00643); we have:
[tex]\mathsf{C_{\dfrac{0.03002}{0.006432}}H_{\dfrac{0.0361}{0.00643}}N_{\dfrac{0.00643}{0.00643}}}[/tex]
= [tex]\mathsf{C_{4.7}H_{5.7}N}[/tex]
Thus, multiplying the subscript by 2.1, we have:
[tex]\mathsf{C_{4.7 \times 2.1}H_{5.7 \times 2.1}N_{1\times 2.1}}[/tex]
Thus, the empirical formula = [tex]\mathbf{C_{10}H_{12}N_{2}}[/tex]
The mass of the empirical formula is:
= (10 × 12.010 u) + (12 × 1.008 u) + ( 2 × 14.007 u)
= 160.21 u
Thus, because the molecular mass 324 g/mol is double the value of the empirical formula, the molecular mass is definitely double the empirical formula;
i.e
Molecular formula = [tex]\mathbf{C_{10\times 2}H_{12\times 2}N_{2\times 2}}[/tex]
Molecular formula = [tex]\mathbf{C_{20}H_{24}N_{4}}[/tex]
what is the measure of the average kinetic energies of all the molecules in substance?
Answer:
Kinetic theory of gases is a description of gas as a large number of non-stop random moving particles (atoms or molecules, generally without distinction in physics, are called molecules). Fast-moving molecules continuously collide with other molecules or the walls of the container. Molecular motion theory is to explain the macroscopic properties of gas, such as pressure, temperature, volume, etc., through the composition and motion of molecules. The theory of molecular motion believes that pressure does not come from static repulsion between molecules, as Newton’s conjecture, but from collisions between molecules that move thermally at different speeds.
The molecule is too small to be seen directly. The random movement of pollen particles or dust particles under the microscope-Brownian motion, is a direct result of molecular collisions. This can be used as evidence of the existence of the molecule.
Temperature is a measure of the average kinetic energy of the particles in a substance. Temperature of a volume of air represents the average kinetic energy of its molecules. Temperature is a measure of the average kinetic energy of a substance.
According to Kinetic Molecular Theory, the average kinetic energy of gas molecules is a function only of temperature. where T is the Kelvin temperature and k is Boltzmann's constant.
2) 3,160 tons of water flows over Niagra Falls every second. Assuming the water has a density of 1.00 g/ml,
how much time would it take the water to fill up a cylinder with the diameter of a school garbage can (53 cm)
that stretched to the moon, which is on average 236,000 miles from the earth? Answer in a time unit that is
most meaningful (for example 1.40 days is more meaningful than 121,000 seconds). 1 ton = 2000 pounds
Answer:
Time = 8.12 h = 0.34 day
Explanation:
First we find speed of water flow:
Speed = u = (3160 tons/s)(907.185 kg/1 ton)
u = 2866704.6 kg/s
also,
Density = (1 g/mL)(1 mL/1 x 10⁻⁶ m³)(1 x 10⁻³ kg/1 g)
Density = 1000 kg/m³
Now,
Volume Flow Rate = Speed/Density
Volume Flow Rate = (2866704.6 kg/s)/(1000 kg/m³)
Volume Flow Rate = 2866.7 m³/s
Now, we find volume of cylinder:
Volume = (Area)(Length)
Volume = (πd²/4)(L)
Volume = [(π)(0.53 m)²/4][236000 mi][1609.36 m/1 mi]
Volume = 83,792,823.82 m³
Now,
Time = Volume/Volume Flow Rate
Time = (83,792,823.82 m³)/(2866.7 m³/s)
Time = (29299.71 s)(1 h/3600 s)
Time = 8.12 h = 0.34 day
what would happen to global temperatures of solar energy was unbalanced
Answer:
mostly skin diseases
Explanation:
because of greenhouse effects
a jaguar can run up to 50 miles per hour, how many feet can he run per second? give your answer in scientific notation to one and three significant figures.
Answer:
50x10^0
Explanation: