At the beach, Nardia collected triple the number of seashells that Pierre did. Together, they collected 52 seashells. Which equations represents p, the number of seashells that Pierre collected. O 3p+p-52 52+p-3p At the beach , Nardia collected triple the number of seashells that Pierre did . Together , they collected 52 seashells . Which equations represents p , the number of seashells that Pierre collected . O 3p + p - 52 52 + p - 3p​

Answers

Answer 1

Answer:

If Nardia is N and Pierre is P an equation that would represent this problem is 52-3n=p


Related Questions

Josie needs to rent a car from SureRide Car Rentals. The cost of renting a car iS a
one-time fee of $80 plus $0.75 per mile. Write and graph an equation to represent
pay tO rent a car a from SureRide.
the cost which Josie must

Answers

Answer: y = 0.75x + 80

Step-by-step explanation:

let x = 1 mile

y = 0.75x + 80

A rectangular pyramid has a height of 6 units and a volume of 40 units3. Shannon states that a rectangular prism with the same base area and height has a volume that is three times the size of the given rectangular pyramid. Which statement explains whether Shannon is correct?

A rectangular prism in which BA = 20 and h = 6 has a volume of 40 units3; therefore, Shannon is incorrect.
A rectangular prism in which BA = 6.67 and h = 6 has a volume of 40 units3; therefore, Shannon is incorrect.
A rectangular prism in which BA = 20 and h = 6 has a volume of 120 units3; therefore, Shannon is correct.
A rectangular prism in which BA = 6.67 and h = 6 has a volume of 120 units3; therefore, Shannon is correct.

Answers

Answer:

The first statement is true so Shannon is incorrect.

Step-by-step explanation:

Volume of the pyramid with base  20 and h = 6

= 1/3 * base area * height

= 1/3 * 20 * 6

= 40 unit^3.

If f(x) = −3x 4 and g(x) = 2, solve for the value of x for which f(x) = g(x) is true. x =

Answers

The value of x for the equation to the true is 2/3

Solution to equation

Given the following functions

f f(x) = −3x + 4 and;

g(x) = 2

If the functions are equal, then;

-3x + 4 = 2

Subtract 4 from both sides

-3x = 2 - 4

-3x = -2

x = 2/3

Hence the value of x for the equation to the true is 2/3

Learn more on equation here: https://brainly.com/question/13763238

#SPJ1

Identify two angles that are marked
congruent to each other on the diagram
below. (Diagram is not to scale.)

Answers

Answer:

Angles G and H are congruent.

Step-by-step explanation:

1
2
4
10
01:28:2
solve x2 + 12x = -11 by completing the square. which is the solution set of the equation?
be
o {-11, -1}
o {-11, 1}
{11, -1}
o {11, 1}

Answers

First, make the equation equal to zero:
x^2 + 12x + 11 = 0

then complete the square
(x + 6)^2 - 36 + 11 = 0
(x + 6)^2 - 25 =0

(x + 6)^2 = 25

take the square root of both sides

(x + 6) = 5 or (x + 6) = -5

then, isolate x,

x = -1 or x = -11

Answer:

11

Step-by-step explanation:

Find the common difference and the SIMPLIFIED general term formula.
3) a 14=1322 and a 38 = 3722

I reallyyyy need help!!! ASAP PLEASE!!!!!

Answers

Answer:

[tex]a_{n}[/tex] = 100n - 78

Step-by-step explanation:

the nth term of an arithmetic sequence is

[tex]a_{n}[/tex] = a₁ + (n - 1)d

where a₁ is the first term and d the common difference

given a₁₄ = 1322 and a₃₈ = 3722 , then

a₁ + 13d = 1322 → (1)

a₁ + 37d = 3722 → (2)

subtract (1) from (2) term by term to eliminate a₁

24d = 2400 ( divide both sides by 24 )

d = 100

substitute d = 100 into either of the 2 equations and solve for a₁

substituting into (1)

a₁ + 13(100) = 1322

a₁ + 1300 = 1322 ( subtract 1300 from both sides )

a₁ = 22

then nth term formula is

[tex]a_{n}[/tex] = 22 + 100(n - 1) = 22 + 100n - 100 = 100n - 78

4(p+q) /p-q x q+p/8(p+q)

Answers

Answer:

[tex]\frac{q+p}{2(p-q)}[/tex]

Step-by-step explanation:

[tex]\frac{4(p+q)}{p-q} *\frac{q+p}{8(p+q)}[/tex]

We will cancel out like terms.

[tex]\frac{4}{p-q} *\frac{q+p}{8}\\=\frac{4(q+p)}{8(p-q)} \\=\frac{q+p}{2(p-q)}[/tex]

Convert 0.50 sen /g to RM/kg ​

Answers

the conversion is:

0.50 sen /g = 5 RM/kg

How to change the units?

First, we know that

1sen = 0.01RM

Then we can change:

0.50 sen /g = 0.50*(0.01 RM) /g = 0.005 RM/g

Now we use the relation:

1g = 0.001kg

So we can rewrite:

0.005 RM/g = 0.005 RM/(0.001kg) = 5 RM/kg

So the conversion is:

0.50 sen /g = 5 RM/kg

If you want to learn more about changes of units:

https://brainly.com/question/9032119

#SPJ1

For each expression below, select the letter that corresponds to the equivalent expression from the given list.

is equivalent to expression

is equivalent to expression

is equivalent to expression

Answers

Option 1 corresponds to Part B , Option 2 corresponds to Part D , Option 3 corresponds to Part A , Option 4 corresponds to Part C

The complete question is attached in the image

What is an Expression ?

An expression corresponds to the mathematical statement that consists of variables , Constants and mathematical operators  simultaneously.

Solving the given option will give us the answer.

(x²+15x+65)+(2x-5)*(3x+8)

(x²+15x+65)+(6x²+16x-15x-40)

(7x²+16x+25)

Option 1 corresponds to Part B

(4x+1)*(3x-4)-(5x²-10x-12)

(4x+1)*(3x-4)-(5x²-10x-12)

(12x²-16x+3x-4)-(5x²-10x-12)

(7x²-3x+8)

Option 2 corresponds to Part D

(8x²+19x+4)+(3x+2)*(x-5)

(8x²+19x+4)+(3x²-15x+2x-10)

(11x²+6x-6)

Option 3 corresponds to Part A

(6x+1)*(3x-7)-(7x²-34x-20)

(18x²-42x+3x-7)-(7x²-34x-20)

(11x²-5x+13)

Option 4 corresponds to Part C

To know more about Expression

https://brainly.com/question/14083225

#SPJ1

A glass cylinder with a radius of 7cm has water up to a height of 9cm. A metal cube of 5.5cm edge is immersed in it completely. calculate the height by which the water rises in the cylinder.​

Answers

i love robloox

               n n n nn

two ships leave a port sailing 18km/h and 26 km/h. Their angle between their directions of travel from the port is 39 °. How far part are the skips to the nearest km after 2 hours

Answers

I got 33.02 ➡️ 33km!!
33km I got it right

2. The wind blows the pinwheel below clockwise 180 degrees. What positions would the ribbon labeled A end up in after the wind blows it?

Answers

Answer: In between the red and yellow ribbons

Step-by-step explanation:

When something is rotated 180 degrees, you basically just mirror it. Since this pinwheel has an uneven amount of ribbons, there isn't a ribbon opposite of it, so it would be between red and yellow.

The figure shows the letter M and four of its transformed images—A, B, C, and D:

A coordinate grid is shown from positive 8 to negative 8 on the x-axis and from positive 8 to negative 8 on the y-axis. An image of the letter M is shown on ordered pair 1, 2 and 1, 4 and 2, 3 and 3, 12, and 3, 4. Another image of letter M is shown on ordered pair 4, negative 4 and 4, negative 2 and 5, negative 3 and 6, negative 2 and 6, negative 4. This M is labeled as B. Another image of letter M labeled C is shown on negative 4, negative 4 and negative 4, negative 2 and negative 3, negative 3 and negative 2, negative 2 and negative 2, negative 4. An image of the letter W labeled A is shown on 1, negative 2 and 1, negative 4 and 2, negative 3 and 3, negative 2 and 3, negative 4. Another image of the letter W labeled D is shown on negative 2, 4 and negative 2, 2 and negative 3, 3 and negative 4, 2 and negative 4, 4. The letters A, B, C, D are written towards the bottom left of the respective W and M.

Which of the four images was formed by a reflection of the letter M?

A
B
C
D

Answers

The image was formed by a reflection of the letter M would be image A in the second quadrant b the reflection on X-axis. The correct option is A.

Explanation of how reflection across axis works?

When a graph is reflected along an axis, say x axis, then that leads the graph to go just in the opposite side of the axis as if we're seeing it in a mirror.

If you study it more, you will find that it's symmetric, thus each point is equidistant from the axis of reflection as that of the image of that point.

Thus, if you're reflecting a point (x,y) along the x-axis, then its x abscissa will stay the same but y coordinates will negate.

Thus (x,y) turns to (x, -y)

Similarly, if you're reflecting a point (x,y) along the y -axis, the resultant image of the point will be (-x,y).

The image was formed by a reflection of the letter M would be image A in the second quadrant b the reflection on X-axis. The correct option is A.

Learn more about reflection images here;

https://brainly.com/question/24207108

#SPJ1

The reflection of letter M is (A)

What is reflection?

A figure is said to be a reflection of the other figure, then every point in a figure is at equidistant from each corresponding point in another figure.

According to the graph the reflection of Of letter M is with same coordinates but with x as positive and y as negative.

Hence the reflection is (A).

Learn more about reflection here:

https://brainly.com/question/15487308

#SPJ1

is this correct ?-?
I need to get this done lol

Answers

Answer:

6

Explanation:

[tex]\textsf {The range of a data representation refers to difference of the smallest and }\\\textsf {greatest possible values. }[/tex]

[tex]\textsf {Here :}[/tex]

[tex]\textsf {smallest value = 5}\\\textsf {greatest value = 11}[/tex]

[tex]\textsf {Then the range will be :}\\\implies \textsf {greatest value - smallest value}\\\implies \mathsf {11 - 5}\\\implies \mathsf {6}[/tex]

PLEASE HELP 20 POINTS
Quadrilateral A'B'C'D' is the image of quadrilateral ABCD under a rotation about point P.
A -105
B -75
C 75
D 105

Answers

Quadrilateral A'B'C'D' is the image of quadrilateral ABCD under a rotation about point P at; D: 105°

How to Interpret Rotation of objects?

From the given image, If we connect points C of the blue quadrilateral to point C' of the rotated quadrilateral using the center of rotation P, then we will notice that ∠CPC' will be greater than 90°.

Now, the rotation is counterclockwise and it therefore means that the angle of rotation is will be positive and since ∠CPC' is greater than 90°, then we can say that the only correct option is Option D which is 105°

Read more about Objects Rotation at; https://brainly.com/question/26249005

#SPJ1

write the faction in the simplest form 28/36

Answers

Answer:

7/9

Step-by-step explanation:

Divide the numerator and denominator by 4.

28/36 = 7/9

Answer:

7/9

Step-by-step explanation:

28 and 36 are both divisible by 4.

28÷4 is 7 and

36÷4 is 9

28/36 = 7/9

Bronze is a mixture of copper and tin.
The copper and tin are in the ratio 9:1.
a) How much tin is there in a bronze bracelet
weighing 260 grams?
6

Answers

Answer:

26 gm

Step-by-step explanation:

Tin is   1   out of (9+1)   = 1/10 th

1/10th * 260 gm  =   26 gm

Round 38.856 to the nearest tenth

Answers

38.9 is the answer to the question

Answer:38.9

Step-by-step explanation:

please help, performance task: trigonometric identities

Answers

The solutions to 1 - cos(x) = 2 - 2sin²(x) from (-π, π) are (-π/3, 0.5) and (π/3, 0.5)

How to solve the trigonometric equations?

Equation 1: 1 - cos(x) = 2 - 2sin²(x) from (-π, π)

The equation can be split as follows:

y = 1 - cos(x)

y = 2 - 2sin²(x)

Next, we plot the graph of the above equations (see graph 1)

Under the domain interval (-π, π), the curves of the equations intersect at:

(-π/3, 0.5) and (π/3, 0.5)

Hence, the solutions to 1 - cos(x) = 2 - 2sin²(x) from (-π, π) are (-π/3, 0.5) and (π/3, 0.5)

Equation 2: 4cos⁴(x) - 5cos²(x) + 1 = 0 from [0, 2π)

The equation can be split as follows:

y = 4cos⁴(x) - 5cos²(x) + 1

y = o

Next, we plot the graph of the above equations (see graph 2)

Under the domain interval [0, 2π), the curves of the equations intersect at:

(π/3, 0), (2π/3, 0), (π, 0), (4π/3, 0) and (5π/3, 0)

Hence, the solutions to 4cos⁴(x) - 5cos²(x) + 1 = 0 from [0, 2π) are (π/3, 0), (2π/3, 0), (π, 0), (4π/3, 0) and (5π/3, 0)

Read more about trigonometry equations at:

https://brainly.com/question/8120556

#SPJ1

please help .. . . .

Answers

Answer:

Step-by-step explanation:

Please please help what is equivalent to this??

Answers

The correct option is Option A: [tex]16^{3x/4}[/tex] is equivalent to the expression  [tex](\sqrt[4]{16})^{3x[/tex].

The rules of the exponent are

(a) [tex]a^m*a^n=a^{m+n[/tex]

(b)[tex]a^m/a^n=a^{m-n[/tex]

(c)[tex](a^b)^c=a^{bc}[/tex]

(d) [tex]\sqrt[n]{a}=a^{1/n[/tex]

here the given expression is [tex]16^{3x/4}[/tex]

we can rewrite the expression as

[tex]16^{3x/4}[/tex]

as we know by the rule of the exponent that    [tex](a^b)^c=a^{bc}[/tex]

=[tex](16^{1/4})^{3x[/tex]

as we know by the rule of the exponent  [tex]\sqrt[n]{a}=a^{1/n[/tex]

=[tex](\sqrt[4]{16})^{3x[/tex]

Therefore the correct option is Option A: [tex](\sqrt[4]{16})^{3x[/tex]

Learn more about exponent

here: https://brainly.com/question/535578

#SPJ10

can someone please help me

Answers

Answer:

Domain: All real numbers

Range: y≤4

fill in the blank
83 x 391 - 83 x ____ = 83 x (391 - 15)

Answers

Answer:

83 x 391 - 83 x 15 = 83 x (391 - 15)

Step-by-step explanation:

BODMAS is stands for Bracket Of Division Multiplication Addition and Subtraction.

left hand side:

83 × 391 - 83 × ____   = 32453 - 83 × ____

right hand side:

83  × (391 - 15) = 83 × 376 = 31208

equating both sides

32453 - 83 × ____ = 31208

32453 - 31208 = 83 × ____

1245 ÷ 83 = 15

hence the answer is 15.

Learn more about BODMAS here - https://brainly.in/question/3531664

#SPJ10

Use the graphs below to answer the following questions: a. g(f(2) b. f(f(1)) c. f(g(2))

Answers

Answer:

19-73 19-73 and a very nice little

Step-by-step explanation:

19-73 19-73 and he changed

A certain species of virulent bacteria is being grown in a culture. It is observed that the rate of growth of the bacterial population is proportional to the number present. If there were 1000 bacteria in the initial polulation and the number doubled after the first 30 minutes, how many bacteria will be present after 4 hours

Answers

Answer:

  256,000

Step-by-step explanation:

If the culture doubles in size every 30 minutes, it doubles 2 times per hour. In 4 hours it will have doubled 2×4 = 8 times. Each doubling multiplies the number by 2, so 8 doublings will multiply the number by 2^8.

The population will be ...

  1000×2^8 = 256,000 . . . bacteria present after 4 hours

Horizontal lines n and m are intersected by lines q and p. At the intersection of lines q and n, the uppercase right angle is angle 4. At the intersection of lines q and m, the uppercase left angle is angle 1. At the intersection of lines p and n, the bottom left angle is angle 3. At the intersection of lines p and m, the uppercase left angle is angle 2.

If angle 1 is 110°, what would the other angle measures have to be in order for m || n and
q || p?



Angle 2 = °



Angle 3 = °



Angle 4 =

Answers

The values of the angles based on the information will be:

Angle 2 = 110°

Angle 3 = 70°

Angle 4 = 70°

How to calculate the angles?

From the information given, angle 1 is 110° and the horizontal lines n and m are intersected by lines q and p.

In this case, it should be noted that vertcally opposite angles are equal. Hence, angle 2 is also 110°.

Angle 3 will be:

= 180° - 110° = 70° (angle on a straight line).

Angle 4 will also be 70° as a vertically opposite angle to angle 3.

Learn more about angles on:

brainly.com/question/25716982

#SPJ1

Answer:

The values of the angles based on the information will be:

Angle 2 = 110°

Angle 3 = 70°

Angle 4 = 70°

Step-by-step explanation:

simplify 26a7 + (-25a7)

Answers

Answer:

1a7

Step-by-step explanation:

26+-25=1

Question 3 of 10
Evaluate: (4/5) 1/2
O A. 2/25
O B. 2/5
O C.4:5
O D.4/25

Answers

Answer:

2/5

Step-by-step explanation:

Can I have the solution with steps

Answers

Answer:

1/6

Step-by-step explanation:

As usual in trigonometry, there are so many relationships between the trigonometric functions, there is bound to be more than one method to arrive at the answer.

Knowing values for the sine and cosine function for certain angles on the unit circle proves to be quite helpful.  In general, I recommend 0°, 30°, 45°, 60°, and 90° at a minimum.

Recall the following 6 things:

[tex]\cos(30^o)=\frac{\sqrt{3}}{2}[/tex][tex]\cos(60^o)=\frac{1}{2}[/tex][tex]\sin(30^o)=\frac{1}{2}[/tex][tex]\sin(60^o)=\frac{\sqrt{3}}{2}[/tex][tex]\tan(\theta)=\dfrac{\sin(\theta)}{\cos(\theta)}[/tex][tex]\tan^2(\theta)=\tan(\theta)\tan(\theta)[/tex]

Knowing these 6 things (4 things from the unit circle, a way to write the tangent function in terms of sine and cosine, and the definition of a squared trig function), we can simplify the given expression down to a single number:

The definition of the tangent squared function is that the output of the tangent function is squared...

[tex]\dfrac{1-\tan^2(30^o)}{1+\tan^2(60^o)}=\dfrac{1-(\tan(30^o))^2}{1+(\tan(60^o))^2}[/tex]

Using fact 5, and turning the tangent function into sines and cosines...

[tex]=\dfrac{1-\left(\frac{\sin(30^o)}{\cos(30^o)}\right)^2}{1+\left(\frac{\sin(60^o)}{\cos(60^o)}\right)^2}[/tex]

Using facts 1-4, and substituting known values for sines and cosines...

[tex]=\dfrac{1-\left(\frac{(\frac{1}{2})}{(\frac{\sqrt{3}}{2})}\right)^2}{1+\left(\frac{(\frac{\sqrt{3}}{2})}{(\frac{1}{2})}\right)^2}[/tex]

Division is multiplication by the reciprocal...

[tex]=\dfrac{1-\left(\frac{1}{2}*\frac{2}{\sqrt{3}}\right)^2}{1+\left(\frac{\sqrt{3}}{2}*\frac{2}{1}\right)^2}[/tex]

Reducing/simplifying common factors of 2...

[tex]=\dfrac{1-\left(\frac{1}{\sqrt{3}}\right)^2}{1+(\sqrt{3})^2}[/tex]

Squaring a square root...

[tex]=\dfrac{1-\left(\frac{1}{3}\right)}{1+(3)}[/tex]

Finding a common denominator...

[tex]=\dfrac{\frac{3}{3}-\frac{1}{3}}{4}[/tex]

Definition of subtracting fractions...

[tex]=\dfrac{\frac{3-1}{3}}{4}[/tex]

Arithmetic...

[tex]=\dfrac{\frac{2}{3}}{4}[/tex]

Division is multiplication by a reciprocal...

[tex]=\dfrac{2}{3}*\dfrac{1}{4}[/tex]

Simplification and reducing the fraction...

[tex]=\dfrac{1}{6}[/tex]

So, [tex]\dfrac{1-\tan^2(30^o)}{1+\tan^2(60^o)}=\dfrac{1}{6}[/tex]

Which of the following is the solution to 3I x-1 I≥ 12?
A. x≤ -3 or x≥ 5
B. x≤ -3 and x≥ 5
C. x≥ 5
D. x≥ -3 or x≥ 5

Answers

The solution for the given inequality will be x≤ -3 or x≥ 5. Thus, the correct option is B.

What are inequalities?

Inequalities help us to compare two unequal expressions. Also, it helps us to compare the non-equal expressions so that an equation can be formed. It is mostly denoted by the symbol <, >, ≤, and ≥.

For the given inequality the solution can be found as,

When the value of x is negative,

         3|x-1| ≥ 12

         x-1 ≥ 4

         x ≥ 5

When the value of x is positive,

         3|x-1| ≥ 12

         - x + 1 ≥ 4

         -x ≥ 3

         x ≤ -3

Hence, the solution for the given inequality will be x≤ -3 or x≥ 5. Thus, the correct option is B.

Learn more about Inequality:

https://brainly.com/question/19491153

#SPJ1

Other Questions
Read the excerpt from "The Crab That Played with the Sea.He went North, Best Beloved, and he found All-the-Elephant-there-was digging with his tusks and stamping with his feet in the nice new clean earth that had been made ready for him.Kun? said All-the-Elephant-there-was, meaning, Is this right?Payah kun, said the Eldest Magician, meaning, That is quite right; and he breathed upon the great rocks and lumps of earth that All-the-Elephant-there-was had thrown up, and they became the great Himalayan Mountains, and you can look them out on the map.He went East, and he found All-the-Cow-there-was feeding in the field that had been made ready for her, and she licked her tongue round a whole forest at a time, and swallowed it and sat down to chew her cud.Kun? said All-the-Cow-there-was.Payah kun, said the Eldest Magician; and he breathed upon the bare patch where she had eaten, and upon the place where she had sat down, and one became the great Indian Desert, and the other became the Desert of Sahara, and you can look them out on the map.He went West, and he found All-the-Beaver-there-was making a beaver-dam across the mouths of broad rivers that had been got ready for him.Kun? said All-the-Beaver-there-was.Payah kun, said the Eldest Magician; and he breathed upon the fallen trees and the still water, and they became the Everglades in Florida, and you may look them out on the map.Then he went South and found All-the-Turtle-there-was scratching with his flippers in the sand that had been got ready for him, and the sand and the rocks whirled through the air and fell far off into the sea.Kun? said All-the-Turtle-there-was.Payah kun, said the Eldest Magician; and he breathed upon the sand and the rocks, where they had fallen in the sea, and they became the most beautiful islands of Borneo, Celebes, Sumatra, Java, and the rest of the Malay Archipelago, and you can look them out on the map!Which details from the excerpt best support the conclusion that this story is about the creation of the world? Select two options.Things turn into geographical features of the Earth, such as the Himalayas, when the Eldest Magician blows on them.The Eldest Magician and the animals engage in conversations using language, which is an example of personification.The animals engage in activities that are typical of their species, such as the cow chewing its cud and the beaver building a dam.The author repeats foreign expressions such as "Kun" and "Payah kun" in the conversations between the Magician and the animals Explain how cache (SRAM) can support CPU pipelining. Gerald is constructing a line parallel to line l through point P. He begins by drawing line m through points P and Q. He then draws a circle centered at Q, which intersects line l at point N and line m at point S. Keeping the compass measure, he draws a congruent circle centered at point P, which intersects line m at point T.Which next step will create point R, such that when a line is drawn through points P and R, the line will be parallel to line l?Lines m and n intersect at point Q. A circle is drawn around point Q and forms point S on line m and forms point N on line l. Point P is also on line m. A circle is drawn around point P and forms point T on line m.Use the compass to construct a circle centered at Q through point P.Using the compass measure between points S and N, draw an arc to the right of line m, centered at T, intersecting the edge of circle P.Using the compass measure between points S and N, draw an arc above line l, centered at N, intersecting the edge of circle Q. Use the compass to construct a circle centered at P through point Q.Mark this and return 2.how are the amino acids formed from the codon in mutation #2 different from those formed from the original codon pattern. Which of the following is not a constitutional role of the president? (3 points) Which of these will complete the simple sentence?Mee Younga. was a great math student, but she did notenjoy her English classes as muchb. and Henry practiced for their duet for hoursAc. got sick right before the performance;however, she was able to complete her solonone of thesePlease select the best answer from the choices providedBd. none of these If 1 < a x , then the minimum value of [tex] \rm log_{a}(x) + log_{x}(x) [/tex] is ?PLEASE HELP!!!! how to solve superstition In the decade between 1882 and 1892, lynching rose in the South by an overwhelming 200 percent, with more than 241 black people killed. Lynching was used as a means of social control to terrorize and intimidate blacks. Which cultural myth was used to justify and legitimate the practice of white mobs lynching black people Juan is learning about like terms in his math class. He must check all the combinations below that are like terms which ones should he check What is the value of p? essay on depending on other countries very harmful to us James has $1500 to open a checking account. He can maintain a monthly balance of at least $1000. He plans to use the ATM four times per month at his local branch. He does not overdraft his account and plans to use direct deposit. He also plans to pay his bills online and he averages 8 bills per month. Bank Account Terms and Conditions James wants an account with the lowest fees. Which checking account would be best for James A recent order for 15,000 items of building supplies was composed of bolts and nails. Nails cost 5 cents each. The entire order arrived at an expense of 1500 dollars. If there were 2500 bolts, what is the cost of each bolt? Which factor contributed to European global exploration during the 15th to18th centuries? D 37 = 40D = Check your solution. 37 = 40 The boys (clean) the car. It looks new again. Problem 4 (a) three friends are packing sweets into gift boxes. they agree that each box should contain the same number of sweets, but they are each working in separate locations with their own pile of sweets so cannot share boxes. gwen has 286 sweets, bill has 390 sweets and zeta has 468 sweets. if they put the largest number of sweets into each box that they can and they use up all their sweets, how many boxes of sweets will they pack? (b) use the euclidean algorithm to find the highest common factor of 8008 and 24255 (you need to show all working). Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom why Germany was fertile soil for the Nazis following World War I?