Given the function f(x) = 4x evaluate

f(-2)

Answers

Answer 1

Answer:

the answer =-8

Step-by-step explanation:

you subsitute -2 for x so its 4(-2) which is -8

Answer 2

Answer:

Given value x=-2, just substitute it to [tex]4^{x}[/tex]

= [tex]4^{-2}[/tex]   (this uses the property [tex]a^{-m}=\frac{1}{a^{m} }[/tex])

= This results in:

[tex]\frac{1}{4^{2} } = \frac{1}{16 }[/tex]


Related Questions

these are 3 different questions. if you answer can u explain so it can help me please.

Answers

Answer:

ans of problem 12 is:

x=65

y=10

Answer:

Step-by-step explanation:

Problem 12:

I think that (2x-y)+60=(2x+y)+40

Because of the Alternate Interior Angles theorem, which places the 40 next to (2x+y) so then you know they are a linear pair. Same can be done for the side with the 60 degree angle. So both sides add up to 180 so they are congruent themselves and you can put them in this format:

(2x-y)+60=(2x+y)+40

         -40             -40

We do this to remove the 40 from the right side completely, and whatever you do to one side of the equation you have to do to the other as well so remove 40 from both.

(2x-y)+20=(2x+y)

-2x             -2x

Again, we are just trying to find out y right now

-y +20=y

+y        +y

20 = 2y

10 = y

Then insert the y into an equation telling us that it is equal to 180 (because we know that from before) to get what x is

(2x-y)+60=180

We can also input our y that we found out was 10 from before:

(2x-10)+60=180

And now we can add up 60 and -10

2x+50=180

Now subtract 50 to both sides

2x=130

And divide both sides by 2

x=75

So x=75 and y=10

Feel free to ask any questions

Problem 13:

The same type of working out, just with different numbers

factorise x2-10x-24 plz help ​

Answers

Answer:

(х-4)(х-6)

Step-by-step explanation:

х¹= 4

х²=6

easy

Answer:

(x - 12)(x + 2)

Step-by-step explanation:

Given

x² - 10x - 24

Consider the factors of the constant term (- 24) which sum to give the coefficient of the x- term (- 10)

The factors are - 12 and + 2 , since

- 12 × + 2 = - 24 and - 12 + 2 = - 10 , thus

x² - 10x - 24 = (x - 12)(x + 2) ← in factored form

What is the answer to 24x + 2y =48 for x

Answers

If your looking for the x-intercept then is would be 2
Hope this helps

find the area of the figure above

Answers

Need more information in order to help you!

The area of the shape that is the combination of rectangle and trapezoid will be 71 square inches.

What is the area?

The quantity area demonstrates the amount of a sector on a planar or hemispherical cup. Surface area refers to the area of an open surface or the border of a multi-object, whereas the area of a plane region or plane field refers to the area of a form or planar material.

The shape is a combination of a rectangle and a trapezoid.

The area is the summation of the area of the rectangle and the area of the trapezoid. Then we have

Area = Area of the rectangle + Area of the trapezoid

Area = 5 x 9 + (1/2) x (4 + 9) x 4

Area = 45 + 26

Area = 71 square inches

The area of the shape that is the combination of rectangle and trapezoid will be 71 square inches.

More about the area link is given below.

https://brainly.com/question/27683633

#SPJ2

The missing graph is given below.

a.
The expression V18+ V8 is equivalent to
572
b. 1072
2V9
d. 26
c.
b

Answers

The answer is A :)

0.6x + 3 = 0.1x - 7 what value of x makes the question true

Answers

Answer:x=-20

Step-by-step explanation:

what are warnings sopposed to mean on here????
and guess how many i have and tell me urs

Answers

Answer:

basically, if you do something against guidelines, you get a warning.

Step-by-step explanation:

id say you have 1, i have 0 lolol

Answer:

They mean that you posted unrealated things and if you do more times something will happen like you will get band i guess i have 0

Step-by-step explanation:

A carpenter wants to cut a board that is five sixth ft long into pieces that are five sixteenths ft long. The carpenter will use the expression shown to calculate the number of pieces that can be cut from the board. five sixth divided by five sixteenths. Which expression can also be used to calculate the number of pieces that can be cut from the board?

Answers

Answer:

N = L/P

8/3 pieces

Step-by-step explanation:

Length of the board = 5/6 ft

A carpenter wants to cut a board that is five sixth ft long into pieces that are five sixteenths ft long.

Length of each piece = 5/16 ft

Number of pieces that can be cut from the board = Total length of board / length of each piece

Let

N = Number of pieces that can be cut from the board

L = Total length of board

P = length of each piece

N = L / P

= 5/6 ÷ 5/16

= 5 / 6 × 16 / 5

= 80 / 30

= 8/3

The number of pieces that can be cut from the board is 8/3

How many angles are there?

Answers

Answer:

There are 7 angles.

Step-by-step explanation:

Find the sum.

(8x^4+2x^2−1) + (3x^3−5x^2+7x+1)

Answers

Answer: 8x⁴ + 3x³ -3x² + 7x

Answer: 8x^4+3x^3-3x^2+7x

Step-by-step explanation: just simplify the equation

need answers quick please!!

Answers

Answer:

1. X=3/a

2. x=-6/a

3. x=-a/6

Help with math...i will give brainlys

Answers

Keep this for future reference.

Answer:

1a. corresponding angles

1b. alternate exterior angles

1c. same side interior angles

2. it is simple, solve for x just like in Algebra, x=9

4x+2=7x-25

4x+27=7x

27=3x

9=x

Step-by-step explanation:

1/2n+3=6 solve for n​

Answers

Answer:

i think this is your ans

mark as brainliest

plezzz.....

Answer:

If you meant (1/2)*n+3=6, n=6. If you meant 1/(2*n)+3=6, n=1/3.

P.s.

Please give me brainliest for my next rank

What is the arc measure for WX
X=10 btw

Answers

Answer:

  106°

Step-by-step explanation:

The intercepted arc is double the measure of the inscribed angle intercepting it. Each of the angles V and Y is 53°, so arc WX is 2×53° = 106°.

Find the percent of decrease. Round to the nearest whole percent.
old: 374 boxes; new: 130 boxes

Answers

Answer:

B

Step-by-step explanation:

−7+3(−4e−3) equivalent expression

Answers

48.61938 if your awnser needs to be rounded up do so to get the correct awnser

Is d=(10)+(-20) d=10)(5 d=(-35)+(

Answers

Answer:

d=7

Step-by-step explanation:

Mr. Wong wants to purchase 12 new smoke detectors for his house. Store A sells each smoke detector for $17 and Store B sells each smoke detector for $24. If Mr. Wong purchases all his smoke detectors at Store A, how much less will he spend than if he purchased all the smoke detectors at Store B?

Answers

Answer:

$84

Step-by-step explanation:

so for store A, you would do $17*12 smoke detectors,  Which would give you $204. For store B you would do $24*12 smoke detectors. That is $288. Now all you do is 288-204=84. You would save $84 dollars going to store A

An expression is a way of writing a statement with more than two variables or numbers with operations such as addition, subtraction, multiplication, and division.

The amount less spend by buying in store A than in store B is $84

What is an expression?

An expression is a way of writing a statement with more than two variables or numbers with operations such as addition, subtraction, multiplication, and division.

Example: 2 + 3x + 4y = 7 is an expression.

We have,

The number of smoke detectors to be purchased.

= 12

Store A:
Cost of one smoke detector = $17

Cost of 12 smoke detectors.

= 12 x 17

= $204

Store B:

Cost of one smoke detector = $24

Cost of 12 smoke detectors.

= 12 x 24

= $288

Now,

The difference between the cost of 12 smoke detectors from store A to store B.

= $288 - $204

= $84

Thus,

The amount less spend by buying in store A than in store B is $84

Learn more about expressions here:

https://brainly.com/question/3118662

#SPJ5

Which is an equivalent form of the following equation?
2x – 3y = 3

Answers

You didn’t give a picture but I solved it in slope intercept form. The answer for that is y=2/3x-1
If you need it in another form let me know

Answer:

y=2/3x - 1

Step-by-step explanation:

2x-3y=3

-2x      -2x

-3y= -2x + 3

÷-3     ÷-3   ÷-3

y= -2/3 x  - 1

Deposit $125 in your checking account ​

Answers

Answer:

??

Step-by-step explanation:

Answer:

You are adding $125 into your checking account.

Step-by-step explanation:

2# ANSWER SOON

Write an equation that represents the line

Use exact numbers.

Answers

Answer:

y = -4/3 - 1

Step-by-step explanation:

Solve 3/5 + 2/5 write The answer in simplest form HURRY PLEASE

Answers

Answer:

Your answer is 1

Step-by-step explanation:

11. A grocery store flyer this week included the sale price information shown below.
Sale Prices
Item
Price
Red Grapes
5 lbs for $5.50
Soft Drink 12-packs 3 for $9.99
Snack Mix Bag $1.50 each
Lunchmeat package $4.25 each
Susan needs to buy 5 lbs of grapes, six 12-packs of soft drinks, and 3 packages of
lunchmeat. How much will Susan spend on her items, not including tax?

Answers

$5.50 = 5 lbs. grapes
$19.98 = 6 12-packs soft drinks (2x9.99)
$12.75 = 3 packages of luncheon meat

Add:
5.50 + 19.98 + 12.75 = $38.23

Susan will spend $38.23 for all the items.

Simplify the following expressions:

x−(x−14)
thanks this should be easy I'm just working on other problems right now and don't want to deal with it

Answers

Answer:

x-(x-14)

Distribute negative one by everything in the parentheses

and you will get x=14

Step-by-step explanation:

Who can help me find the slope? It’s due soon

Answers

Answer: 1.5 or 1 1/2
Explanation: to find the slope you do rise, in this case 6, over run, 4. You divide 6 by 4 and then that’s the slope

Four times Theo’s number added 20 is 10. what is theo’s number ?

Answers

Theos number is -2/5

4x + 20 = 10
-20 -20
4x = -10
x = -4/10
x = -2/5

Answer:

ur mom

Step-by-step explanation:

genehrrddjdhxxhdhdi hope this didnt help

8x-4 can you guys help me solve for x

Answers

Answer:-32

Step-by-step explanation:

8x4=32 add a negative sign

LOTS OF POINTS

Find the Perimeter of the figure below, composed of a parallelogram and one semicircle. Rounded to the nearest tenths place

please don't answer if you are wrong

Answers

Answer:

38.3

Step-by-step explanation:

The perimeter of the figure can be broken down into the perimeter of 3 sides of the parallelogram, and the perimeter of the semicircle (without its diameter).

The three sides of the parallelogram would be 14+14+4=32.

The perimeter of the semicircle would be 1/2*diameter*pi, which is about 1/2*4*3.14=6.28.

Therefore, the perimeter is 32+6.28=38.3 (to the nearest tenths).

HELP URGENT GEOMETRY

Answers

Triangle HGE is congruent to Triangle FGE
Because

- GE = GE ( common side )
- Angle HEG = Angle FEG ( angular bisector )
- Angle HGE = Angle FGE ( angular bisector )

Hence HGE is congruent to FGE through ASA congruency

Anybody wanna help?please

Answers

Answer:

ilysm sm

Step-by-step explanation:

I hope u get the answer I need points IM SO SORRY

Other Questions
Factor 27 + d^ 3completely. In Sign of the Beaver, how did Matt count and keep track of the days that passed? too hell with this and help ig Can you please help me? Let X be an exponential random variable with parameter =2 . Find the values of the following. Use 'e' for the base of the natural logarithm (e.g., enter e^(-3) for e3 ).a) E[(3X+1)2]= b) P(1X2)= PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies please help me please ok so is it fake to be honest???Like i told this boy the truth bc no one ever does nd they called me fake??so it tht fake or no??nd why??