How many moles would 9.02 x 10^25 molecules of HCI equal?

Answers

Answer 1

Answer:

The answer is 149.83 moles

Explanation:

To find the number of moles in a substance given it's number of entities we use the formula

[tex]n = \frac{N}{L} \\[/tex]

where n is the number of moles

N is the number of entities

L is the Avogadro's constant which is

6.02 × 10²³ entities

From the question

N = 9.02 × 10^25 molecules of HCI

We have

[tex]n = \frac{9.02 \times {10}^{25} }{6.02 \times {10}^{23} } \\ = 149.83388704...[/tex]

We have the final answer as

149.83 moles

Hope this helps you


Related Questions

Which is the best way to determine if an object is made of pure silver

Answers

Answer:

The Nitric Acid Test

Explanation:

The Nitric Acid Test is used to check if silver is pure or plated. To do so, file a small part of the item in a discreet area where it cannot be seen. Apply a few drops of nitric acid. If the area turns into creamy white, the silver is pure or sterling. If green, it is probably fake or silver-plated.

Help me please !!!
Which of the following can be inferred from the diagram above that shows the dependence of potential Energy on the Internuclear distance between two atoms?

A)The atoms form a bond with a bond length of 25 pm
B)The atoms form a bond with a bond length of 75 pm
с)The net force between the atoms is attractive at 25 pm
D)The net force between the atoms is attractive at 75 pm

Answers

Answer:

B)The atoms form a bond with a bond length of 75 pm

Round to 4 significant figures. 9.87553​

Answers

Answer:

9.876

Explanation:

3 AgNO3 + K3PO4 - Ag3PO4 + 3 KNO3
What is the reaction

Answers

Answer:

its a Double Displacement (Metathesis) reaction

the balanced equation is 3AgNO3 + K3PO4 → Ag3PO4 + 3KNO3

Explanation:

Viruses and bacteria

Answers

Answer:

Whats the question lolzzzz

Explanation:

The metal was known to have a density of 5.78 g/mL. A graduated cylinder was filled with 22.3 mL of water and after the metal was added the volume was 24.7 mL. What is the mass of the metal?

Answers

Answer:

The answer is 13.87 g

Explanation:

The mass of a substance when given the density and volume can be found by using the formula

mass = Density × volume

From the question

density of metal = 5.78 g/mL

volume = final volume of water - initial volume of water

volume = 24.7 - 22.3 = 2.4 mL

We have

mass = 5.78 × 2.4 = 13.872

We have the final answer as

13.87 g

Hope this helps you

Is ibuprofen conductive in water?

Answers

Yes it is conductive in water

4. Calculate:the mass of the light bulb is the sum of the values on each rider. To get magnified view of the 1-gram rider,place the cursor over that rider (each tick mark represents 0.1 g.)

100-g rider:___________

10-g rider:___________

1-g ruder:___________

Note because the position of the 1-g slider can be estimated to the nearest 0.01 g, the mass measurement is typically recorded to the nearest hundredth.for example, we would write 201.32 g or 146.70 g if the slider is exactly on a 0.1-g tick mark.

5. Practice:use the gizmo to find the mass of the other objects.write their masses below.

Paper clips:__________

Cone:_________

Cube:__________

Answers

Answer:

Look in the picture

Explanation:

Why sulfur has a smaller radius than phosphorus?

Answers

Answer:

the radius of sulfur is smaller than the radius of phosphorous. This is because atomic radius tends to decrease as you go left to right across the periodic table. Because sulfur is farther right than phosphorous is, it has a a smaller radius.

Explanation:

hope this helps :)

Most of the volume of an atom is occupied by
A protons
B the electron cloud
C valence electrons
the nucleus

Answers

Answer:

An atom is made of protons and neutrons which make up the nucleus and electrons that are around the nucleus. Although almost all the mass of an atom is in the nucleus, most of the space that the atom takes up is occupied by the electrons.

In very simple terms, the electrons are in orbits around the nucleus so most of the volume of the atom is empty space within the volume that the electrons occupy. The behaviour of the electrons is often assumed to be orbits but their actual positions are not that simple.

As a final note, all atoms contain neutrons with the exception of hydrogen which can exist as one proton and one electron.

Explanation:

where were atoms formed ?

Answers

Answer:

They were formed right after the "Big Bang" when our known universe originated from pure energy some billions of years ago. The energy was converted to the elementary particles (quarks, gluons, leptons etc...) from which protons and neutrons were formed. From these, atoms of different elements were produced

write a 3 sentence summary about DNA.
I’ll mark you as the brainiest answer !!

Answers

Answer:

DNA is a complex, long-chained molecule. DNA contains the genetic blueprint for building and maintaining all living organisms. Found in nearly all cells, DNA carries the instructions needed to create proteins, specific molecules essential to the development and functioning of the body.

deoxyribonucleic acid are nuclei acids. the DNA is your genes. we all have different DNA since we get 23 chromosomes from each parent.

A pot of water is heated on a gas-flame stove and begins to boil. Which two
transfers of thermal energy involved in this system are examples of radiation?
A. From the burner to a nearby spoon
B. In the surrounding air as air currents develop
I C. From the burner to air that is not touching it
D. From the water to the air

Answers

Answer:

a.) & d.)

Explanation:

It should ideally go from Mechanical, Electrical, thermal, light then chemical. I attached a similar example to better explain it.

The two transfers of thermal energy involved in this system are examples of radiation are From the burner to a nearby spoon and From the water to the air Hence, option a & d are correct

What is Heat Transfer ?

Heat transfer is a discipline of thermal engineering that concerns the generation, use, conversion, and exchange of thermal energy between physical systems.

Heat transfer is classified into various mechanisms, such as thermal conduction, thermal convection, thermal radiation, and transfer of energy by phase changes.

According to given question, Energy should ideally go from Mechanical, Electrical, thermal, light then chemical.

Therefore, The two transfers of thermal energy involved in this system are examples of radiation are From the burner to a nearby spoon and From the water to the air Hence, option a & d are correct

Learn more about Heat here ;

https://brainly.com/question/12947964

#SPJ2

What is the charge on an electron?

Answers

Answer

1.60217662 × 10-19 coulombs

Explanation:

.

True or False - The central nervous system allows us to sense the environment.

Answers

Answer: no

Explanation: they tell the organs what to sense.  

No the person is right ok yeah love

Which two factors can affect a solid solute's solubility

A. Whether the particles of the solute and solvent are charged

B. Pressure acting and solute

C. Length of time spent stirring

D. Temperatures of the solvent and solute

Answers

Answer:

A and D

Explanation:

It might seem like B and D but I took the test and it's A and D.

Answer:

Whether the particles of the solute and solvent are charged

Temperatures of the solvent and solute

Explanation:

A. Whether the particles of the solute and solvent are charged

B. Pressure acting and solute

C. Length of time spent stirring

D. Temperatures of the solvent and solute

Question 2 of 10
What charge does an ion have if it has more protons than electrons?
O A. Neutral, since protons are inside the nucleus
B. A net positive charge
C. A net negative charge
O D. No charge
SUBMIT

Answers

B. A net positive charge

Answer:

B. A net positive charge

Explanation:

a p e x 2021!

A muffin has a mass of 100g and a volume of 500cm^3. What is the density of the muffin

Answers

Answer:

d = 0.2 g/cm³

General Formulas and Concepts:

Density = mass / volume

Explanation:

Step 1: Define

m = 100 g

V = 500 cm³

d = ?

Step 2: Find density

Substitute:                              d = 100 g/500 cm³Evaluate:                                 d = 1/5 g/cm³Evaluate:                                 d = 0.2 g/cm³

A container of carbon dioxide has a volume of 240 mL at a temperature of 22°C. If the pressure remains constant, what is the volume at 44°C?​

Answers

Answer:

Volume of the [tex]CO_{2}[/tex] gas at 44°C is 258 ml.

Explanation

here,

using Charles' law ,

[tex]\frac{V}{T} =\frac{v}{t}[/tex]

where , V= initial volume          v= final volume

             T=initial temperature    t = final temperature

Given - pressure is constant ,

so , putting the values -

V= 240ml

T= 22 + 273K = 295K                      (since converting celsius into kelvin that

                                                         is +273K )

v =?

t = 44+ 273K = 317K

Now , putting the given values in charles' law ,

[tex]\frac{240ml}{295K} =\frac{v}{317K}[/tex]

240ml x317K = v x 295K     (through cross multiplication )

v =[tex]\frac{240ml\times317K}{295K}[/tex]

= 258ml .

thus , the volume of carbon dioxide in a container at 44°C IS 258ml .

pls help it’s due at 12

Answers

Answer:

it's

D. 2K + 2H2O

Explanation:

it just is

Please help!

Fill in the blank

Answers

Answer:

carbon

Explanation:

10. How many protons, neutrons, and electrons are present in the
140 +3
Ce ion?


Answers

Name: Cerium

Symbol: Ce

Atomic Number: 58

Atomic Mass: 140.116 amu

Number of Protons/Electrons: 58

Number of Neutrons: 82

Fill in the blank. The amount which an object accelerates
depends on the mass of the object and on the size of the
acting upon it.
gravity
velocity
inertia
force

Answers

i think the answer is force

Answer: the answer is force

Explanation:

Identify 5 basic examples of Solutions?

Answers

Coffe
Gasoline
Water
Coffe
Apple juice
A solution is any liquid

Answer:

Coffee

Tea

Juice

Bleach

Salt water

Explanation:

it is difficult to press the football in water why?​

Answers

Answer:

The ball you want to submerge displaces the water occupied in the ball's volume. ... In water the concrete has a buoyancy pressure force equal to the displaced liquid's weight and weighs only 120 pounds until it reaches the surface.

Explanation:

Make a suggestion on how you will deal with the problem

Answers

Answer:

is it a research work?

Explanation:

if it is first u write about what is a climate what r due to climatic changes

Answer:

《<☆HOPE IT WILL HELP YOU 》>☆

Explanation:

Dealing with the problem by

Never lose your hope you're cofidance your power

Always take dlessing or suggeation from the elder or your parent

Please mark my ans as BRAIN LIST

i need help with this ASAP

Answers

A: the ice came from it snowing and the water freezing I the night.

B: there is ice on the windshield because of water water residue that froze.

C: I don’t know sorry.

You run from your house to the grocery store in 1.0 minute, and the store is 300 meters from your house. What is your average speed in meters per second for the trip?

Answers

Answer: 3

Explanation:

How is Science involved in the way a firework works?

Answers

the energy, fire, sparks, the bombs and all that stuff

2(NaHCO3) how many atoms of hydrogen

Answers

Answer:

2 hydrogen atoms

2 Na atoms

2 carbon atoms

6 oxygen atoms

Answer:

11

Explanation:

Other Questions
What has happened to our system of classification as technology has become moreadvanced? Which equation represents a line that is parallel to theline shown on the graph?Piz and ty PLEASE HELP ASAP 5 STARS AND BRAINLIEST TO WHOEVER DOES ALL OF THE PAGE The majority of Canadians live in rural areas. True or False Factor 27 + d^ 3completely. In Sign of the Beaver, how did Matt count and keep track of the days that passed? too hell with this and help ig Can you please help me? Let X be an exponential random variable with parameter =2 . Find the values of the following. Use 'e' for the base of the natural logarithm (e.g., enter e^(-3) for e3 ).a) E[(3X+1)2]= b) P(1X2)= PLEASE HURRY TIMED TESTIn 1988, Diego was fired from his job because he was HIV positive. He was hired at a different company in 1990 and has been working there ever since. What answer best explains why he was not fired from his current position for having HIV?A. Diego was cured of HIV before he accepted the job.B. Blood tests are required of all employees.C. Privacy laws protected Diego from disclosing that information.D. Diego had to tell his boss, who was accepting of his situation. Could someone please answer this question!!? please help asap.. 15 points! Loretta and her friends want to find out which of their pets can run the fastest. Which kind of scientific investigation should they use? A. a controlled experiment B. development of a model C. a review of existing work How well did the Progressive movement address the consequences of industrialization WILL MARK BRAINLIESTJerome has read 50 pages of a novel. He plans to read a certain number of pages, p, each day from Monday to Friday. Which inequality shows that Jerome wants to have read at least 85 pages by the end of the day on Friday? A. 50 + 5p 85B. 50 + 5p 85C. 5 (50 + p) 85D. 5 (50 + p) 85 Which of the following is an equivalent form of the compound inequality-33 > -3x - 6 > -6 Help me pls i need nelp quick!! The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture