i just wnated to finish this im stressed.

I Just Wnated To Finish This Im Stressed.

Answers

Answer 1

Answer:

[tex]\boxed{\displaystyle f^{-1}(x) =\left(\dfrac{x-2}{4}\right)^5 + 1\\}[/tex]

This is the last choice on the screenshot you provided

Step-by-step explanation:

Use y to represent f(x)

[tex]y=4\sqrt[5]{x-1}+2[/tex]

Replace x with y and y with x:

[tex]x=4\sqrt[5]{y-1}+2[/tex]

Solve for y in terms of x and that will be the inverse of f(x)

Switch sides:
[tex]4\sqrt[5]{y-1}+2=x[/tex]
Subtract 2 from both sides:
[tex]4\sqrt[5]{y-1}=x-2[/tex]

Divide both sides by 4
[tex]\sqrt[5]{y-1}=\dfrac{x-2}{4}[/tex]
Raise both sides to the 5th power to get rid of the radical
[tex]\displaystyle \left(\sqrt[5]{y-1}\right)^5=\left(\dfrac{x-2}{4}\right)^5[/tex]

This works out to
[tex]\displaystyle y - 1 =\left(\dfrac{x-2}{4}\right)^5\\[/tex]

Simplifying we get
[tex]\displaystyle y =\left(\dfrac{x-2}{4}\right)^5 + 1\\[/tex]
The right side is the inverse of f(x)

Answer: Last choice on the screen, namely

[tex]\boxed{\displaystyle f^{-1}(x) =\left(\dfrac{x-2}{4}\right)^5 + 1\\}[/tex]


Related Questions

the roots of the polynomial 10x3 - 39x2 29x - 6 are the height, length, and width of a rectangular box (right rectangular prism). a new rectangular box is formed by lengthening each edge of the original box by 2 units. what is the volume of the new box?

Answers

The volume of the new box is 30 units^3.

We can infer the roots are rational integers from the response options, thus this polynomial ought to be simple to factor. The coefficients of x must multiply by 10, hence they must be in some sequence of 5,2,1 or 10,1. Since we can try each one separately, we can express the factored form as follows:

                                       (5x-p)(2x-q)(x-r)

Due to the fact that p, q, and r must multiply to 6, they must be either 3,2,1 or 6,1,1 in some sequence. Once more, we may test each one in a different place to determine if they multiply properly.

When we multiply the x-terms and attempt (5x-2)(2x-1)(x-3), the answer is 29. Try adding the x^2 terms together; they equal -39. Consequently, the roots are [tex]\frac{2}{5} , \frac{1}{2} and 3.[/tex] Now if you add 2 to each root, you get the volume is

=> [tex]\frac{12}{5} X \frac{5}{2} X 5 =30[/tex]

Therefore, The volume of the new box is 30 units^3.

To know more about volume refer to:

brainly.com/question/13338592

#SPJ4

eight children are divided into two teams each containing 4 children to play a game against each other. how many different divisions are possible? group of answer choices 35

Answers

8 children are divided into 2 teams each containing 4 children to play a game against each other. 105 different divisions are possible.

Permutation:

In mathematics, permutation refers to the process of placing all members of a set into an order or sequence. In other words, if the set is already ordered, the permutation of its elements is called permutation. Substitutions occur in more or less noticeable ways in almost all areas of mathematics. They often occur when different orders are considered in a particular finite set.

Combination:

Combining is a way of selecting items from a collection, and (unlike permutation) the order of selection does not matter. In smaller cases you can count the number of combinations. Combining refers to combining n things, taken k times at once, without repetition.

According to the Question:

The first team can be chosen in ⁸C₂ = 28 ways.

After that, there are 6 people left, from which there are ⁶C₂ = 15 ways to choose the second team.

Then, there are 4 people left, out of which ⁴C₂ = 6 ways he can choose the third team. There is only one way to choose the fourth and final team from the remaining two.

In the above procedure, each occasion of splitting eight into her two his four teams counted as 4!= 24 times.

Thus,

The number of ways to divide a group of 8 people into 4 teams of 2 people = 28 × 15 × 6 / 24

            = 105

Learn more about Divide:

https://brainly.com/question/15381501

#SPJ4

Can someone answer this question with an actual answer, I’ll give you brainliest.

Answers

Answer:

A.) Angle A Congruent to Angle D

C.) The scale factor of DE/AB is 2

Step-by-step explanation:

Image shows and supports those.

A spinner with repeated colors numbered from 1 to 8 is shown. Sections 1 and 8 are purple. Sections 2 and 3 are yellow. Sections 4, 5, and 6 are blue. Section 7 is red.

Spinner divided evenly into eight sections with three colored blue, one red, two purple, and two yellow.

Determine the theoretical probability of the spinner not landing on yellow, P(not yellow).

Answers

Answer: P(not yellow) = 6/8

Step-by-step explanation:

It is correct 100%

Answer:

0.625 in decimal form

FILL IN THE BLANK: The three-letter abbreviation for the trigonometric function that relates an angle to the ratio of the (measure of the side) opposite the angle to the (measure of the side) adjacent to the angle is called ______

Answers

Answer:

SohCahToa

Step-by-step explanation:

One scuba diver’s elevation changed by −15 5/8
feet every minute. This was 114
times the rate of change for a second scuba diver.
What was the rate of change in elevation of the second scuba diver in feet per minute?

Answers

Answer:

Step-by-step explanation:

The rate of change in elevation of the second scuba diver in feet per minute would be -15 5/8 / 114 = -0.137 feet per minute.

A circle has a diameter of 7.6 cm
workout the circumferences of the circle
give your answer correct to 3 significant figures

Answers

The circumference of the circle is 23.864

In order to calculate the circumference of a circle, you need to multiply the Diameter of the circle with value of π (pi) which is 3.14.

In the given question,

given, d = 7.6cm

formula : C = d x π

therefore, C = 7.6 x 3.14 = 23.864cm

Write the answer correctly to 3 significant figures.

Alternatively, Circumference can also be calculated by using the value of the radius of the circle. We know, Radius = Diameter/2

Therefore, C = ( 2 x r ) x  π

Symbols:

π = pi ( value = 3.14)

d = diameter

r = radius

C = circumference

For more example of circumference calculation,

brainly.com/question/27177006

curved surface area of a cone = πrl, where r is the radius
and is the slant height.
Work out the total surface area of the cone shown below.
Give your answer to 1 d.p.
21 m
8m
4

Answers

A cone with slant height 21 m and radius 4 m has a total surface area of 100 π m.

What is a cone?

A cone is a shape created by connecting the points on a circular base to a common point, known as the apex or vertex, using a series of line segments or lines (which does not contain the apex).

The formula for curved surface area of cone is = πrl

The formula for total surface area of cone is = πrl + πr²

The slant height value l = 21 m

The diameter is given d = 8 m

The radius is given as r = 4 m

The total surface area is -

TSA = πrl + πr²

TSA = πr (l + r)

TSA = π4 (21 + 4)

TSA = 4 π (25)

TSA = 100 π m

Therefore, the total surface area is 100 π m.

To learn more about cone from the given link

https://brainly.com/question/1082469

#SPJ1

Write out the sample space for the given experiment. Use the following letters to indicate each choice: M for mushrooms, A for asparagus, E for eggs, S for shrimp, V for vinaigrette, and H for honey mustard.
When deciding what you want to put into a salad for dinner at a restaurant, you will choose one of the following extra toppings: mushrooms, asparagus. Also, you will add one of following meats: eggs, shrimp. Lastly, you will decide on one of the following dressings: vinaigrette, honey mustard.
Separate your answers using commas.

Answers

The sample space is given as: S = { MEV, MEH, MSV, MSH, AEV, AEH, ASV, ASH }

The total number of sample points is 8

A sample point is one of the experiment's potential outcomes in a probabilistic experiment. Sample space is the collection of all sample points.

There are two results when you toss a coin: head (H) or tail (T) (T). There are four possible results when tossing two coins: HH, HT, TH, and TT, where the first letter denotes the result of the first toss and the second, that of the second. Each result is referred to as a sample point.

The list of all potential outcomes of an experiment is referred to as the sample space. Regardless of the number of ways an event might occur, each potential result is represented by a single point in the sample space.

For more questions on Sample space and sample points

https://brainly.com/question/24652200

#SPJ4

I need the answer for this question

Answers

Answer:

[tex]\frac{-1}{2}[/tex]

Step-by-step explanation:

Rate of change = [tex]\frac{Change in Y value}{Change in X value}[/tex]

                    Pick any two sets of 'X' and 'Y' value

I chose (-4, 6) as [tex](X_{1} ,Y_{1} )[/tex]and (12, -2) as [tex](X_{2} ,Y_{2} )[/tex] :

Rate of change = Slope / Gradient of graph = [tex]\frac{Y_{2} -Y_{1} }{X_{2} - X_{1} }[/tex]

                                                                         = [tex]\frac{-2 - (6)}{12 - (-4)}[/tex]

                                                                          = [tex]\frac{-2 - 6}{12 + 4}[/tex]

                                                                           = [tex]\frac{-8}{16}[/tex]

                                                                           =  [tex]\frac{- 1}{2}[/tex]

a plant in alamo, tn, manufactures complex transformer components that must meet specific guidelines for safety. one such component is constructed to deliver 1,000 volts of electricity. a component creates a critical safety hazard if it absorbs humidity at a level above 3%. any components that absorb too much humidity will be destroyed. a quality control inspector uses a random sample of components to conduct a hypothesis test with h0: the humidity level absorbed is 3%, and ha: the humidity level absorbed is more than 3%. what is the consequence of a type ii error in this context?

Answers

A type II error in this context would be when the inspector incorrectly fails to reject the null hypothesis (H0), meaning they accept the null hypothesis that the humidity level absorbed is 3% when it is actually more than 3%.

What is hypothesis test?

A hypothesis test is a statistical procedure used to evaluate a hypothesis by using sample data. Brainly experts can use hypothesis tests to verify the accuracy of their answers by collecting sample data, analyzing it and making a conclusion. Hypothesis testing involves formulating a null and alternate hypothesis, generating a test statistic, and using the test statistic to make a decision. Brainly experts can use hypothesis testing to check the validity of their answers and to ensure that they are providing accurate information to their users.

This type of error would result in potentially hazardous components being approved for use and could lead to catastrophic accidents. In other words, if the inspector fails to reject H0 when it is false, it could lead to unsafe components being used and put the health and safety of people in danger.

To know more about hypothesis test click-
https://brainly.com/question/25263462
#SPJ4

every time Musa distributes 100,105&110 oranges to a group of students he is left with 1, 3 ,5 oranges respectively.Find the maximum number of oranges he can distribute to the group

Answers

The maximum number of oranges he can distribute to the ground would be = group C with a total of 115 oranges.

What is a maximum number?

A maximum number is defined as the number that is equal to or greater than other values in a data set.

The various number of oranges distributed by Musa include the following:

Group A Students = 100 oranges

Remaining oranges from group A = 1

Total = 101 oranges

Group B students = 105 oranges

Remaining oranges from group B = 3

Total = 108 oranges.

Group c students = 110 oranges

Remaining oranges from group C = 115 oranges.

Therefore the maximum oranges he distributed was for group C which was 115 in total number.

Learn more about maximum number here:

https://brainly.com/question/29795588

#SPJ1

so for this i just need to know how to find the area and perimeter

Answers

Answer:

Step-by-step explanation:

x=7

Answer: Area: 364 Perimeter: 80

Step-by-step explanation:

Since 2x=14, x=7. Then you plug 7 into 3x+5, so 3(7)+5=26. Then for area you do 14*26=364, and for perimeter you simply do (26+14)2=80

What is the name of the fee charged by a financial institution for withdrawing money from an account before the maturity date?
O A. Surrender charge
O B. Liquidity fee
O C. Early redemption fee

Answers

Surrender charges safeguard against such losses. Surrender costs on some annuities and insurance products can apply for as short as 30 days or as long as 15 years. If you cash in your investment in year one, the surrender cost for annuities and life insurance is typically 10%.

The surrender period is the amount of time that an investor must wait before withdrawing cash from an annuity without penalty. Surrender periods can last many years, and withdrawing funds before the conclusion of the surrender term may result in a surrender charge, which is basically a delayed sales cost.

The longer the surrender time, in general, but not always, the better the annuity's other terms.

The surrender period is the period during which an investor may withdraw funds from an annuity without incurring a surrender charge.

The surrender term can last many years, and annuitants may face large fines if they remove their invested assets before the time has finished.

Other financial instruments include a surrender period as well B-share mutual funds and entire life insurance plans are two examples.

Learn more about withdrawing funds from here;

https://brainly.com/question/17112470

#SPJ1

do most teens recycle? to find out, an ap statistics class asked an srs of 100 students at their school whether they regularly recycle. in the sample, 55 students said that they recycle. is this convincing evidence that more than half the students at the school would say they regularly recycle? the dotplot shows the results of taking 200 srss of 100 students from a population in which the true proportion who recycle is 0.50.

Answers

More data needs to be collected to be able to conclude if more than half the students regularly recycle as the dotplot shows the results are variable.

1. Calculate the proportion of students who reported recycling in the sample:

55/100

= 0.55

2. Calculate the sample size:

100 students

3. Calculate the standard error: SE

= sqrt(0.50*(1-0.50)/100)

= 0.05

4. Calculate the 95% confidence interval:

CI = 0.55 +/- 1.96*SE

= 0.55 +/- 0.098

= (0.45, 0.65)

5. Compare the confidence interval to the true population proportion: 0.50 is not included in the CI, therefore we cannot conclude that more than half the students would say they regularly recycle.

We cannot conclude that more than half of the students would say they regularly recycle because the 95% confidence interval (0.45, 0.65) does not include the true population proportion (0.50). Therefore, more data needs to be collected to be able to draw a conclusion.

Learn more about variable here

brainly.com/question/29583350

#SPJ4

One tray of granola bars was cut into 3 equal-size pieces. A second tray was cut into 9 equal-size pieces, and a third was cut into 6 equal-size pieces. Jan wants to continue cutting until all three trays have the same number of pieces answer

Answers

Each tray will have 18 pieces after they have been cut to the same size.

To find the number of pieces on each tray after they have been cut to the same size, we need to find the least common multiple (LCM) of 3, 6, and 9. This will give us the smallest number of pieces that all three trays can be divided into without any remainder.

The LCM of 3, 6, and 9 is 18. This means that all three trays can be divided into 18 equal-size pieces without any remainder.

So, each tray will have 18 pieces after they have been cut to the same size. It is important to note that this is the smallest number of pieces that all three trays can be divided into, and any larger number would also work.

Read more about the Least common multiple:

brainly.com/question/233244

#SPJ4

The complete question is -

One tray of granola bars was cut into 3 equal-size pieces. A second tray was cut into 9 equal-size pieces, and a third was cut into 6 equal-size pieces. Jan wants to continue cutting until all three trays have the same number of pieces. How many pieces will there be on each tray?

find the given median of the following data 16 14 15 18 17 20 25​

Answers

Answer: 17

Step-by-step explanation:

First, change everything to ascending order.

14, 15, 16, 17, 18, 20, 25

Now, select the middle number, in this case, it is 17.

How do you find the median of a data set?

To find the median of a data set, you must put the numbers in order from least to greatest and find the middle (center) number.

The following data set: 16, 14, 15, 18, 17, 20 and 25 can be organized into the following order: 14, 15, 16, 17, 18, 20, 25.

Now, simply find out the middle number.

17 is the middle number, therefore the median.

Evaluate 8.5 x plus 7.9 y when x equals 7 and y equals 8

Answers

Answer:

=x^2+1 (Graph Example), 4x+2=2 (x+6) (Solve Example) Algebra Calculator is a calculator that gives step-by-step help on algebra problems. See More Examples ». x+3=5. 1/3 +

Step-by-step explanation:

Answer:

y=x^2+1

Step-by-step explanation: 4x+2=2 (x+6)

Mason is working two summer jobs, making $7 per hour babysitting and making $10 per hour clearing tables. In a given week, he can work at most 12 total hours and must earn no less than $90. If a represents the number of hours babysitting and y represents the number of hours clearing tables, write and solve a system of inequalities graphically and determine one possible solution.​

Answers

Answer:

the answer to this question is 107

how many gallons will daniel need? help please thank you

Answers

Measure wall height from floor to ceiling. Exclude baseboards and moldings. Measure length of each wall including doors and windows.

What exactly is the wall formula?

Walls. Use the basic formula of Length x Width = Area to determine the area of a wall. Then, using the same approach, calculate the individual area of windows and doors. After you’ve taken all of these measurements, deduct the area of the windows and doors from the overall wall area. Methods of longwall and shortwall Long walls are those that run the length of the room, whereas short walls are those that run perpendicular to the length of the room.

Next, consider which unit of measurement is most appropriate for measuring a wall. Very tiny units such as inches, centimeters, and millimeters can be ruled out. We can also eliminate.

To learn more about wall formula to refer:

https://brainly.com/question/28273676

#SPJ1

Tyrone is converting startfraction 45 over 50 endfraction to a percent. which method should he use to find the percent? divide the numerator and denominator of the fraction by 2. subtract 40 from the numerator and denominator of the fraction. multiply the numerator and the denominator of the fraction by 2. add 50 to the numerator and denominator of the fraction.

Answers

40% first you turn it into a decimal, then u multiply it by 100 to get your percent.

For solving this question we will use the Unitary method

The unitary approach is a strategy for problem-solving that involves first determining the value of a single unit, then multiplying that value to determine the required value. The term "unitary method" refers to a process where the value of one item is initially determined before determining the values of any other items.

The unitary method's formula is to identify the value of a single unit, then multiply that value by the number of units to obtain the required value.

2/5 = 0.4

0.4 x 100 = 40% first u turn it into a decimal, then u multiply it by 100 to get ur percent

Know more about the percentage at

https://brainly.com/question/843074

#SP4

The full question will be

Tyrone is converting StartFraction 45 Over 50 EndFraction to a percent. Which method should he use to find the percentage?

I. The sum of the probabilities in a probability distribution can be any number between 0 and 1. II. The probability of the union of two events is the sum of the probabilities of those events. III. The probability that an event happens is equal to 1 minus the probability that the event does not happen.

Answers

None of the above gives the complete set of true responses for the probability that the event does not happen.

What is probability?

The field of mathematics concerned with probability is known as probability theory. Although there are various distinct interpretations of probability, probability theory approaches the idea rigorously mathematically by articulating it through a set of axioms. A probability is a number that represents the possibility or chance that a specific event will occur. Probabilities can be stated as proportions ranging from 0 to 1, as well as percentages ranging from 0% to 100%.

Here,

None of the above provides the entire set of accurate replies for the likelihood that the event does not occur.

To know more about probability,

https://brainly.com/question/30034780

#SPJ4

The vertices of quadrilateral ABCD are given. Draw ABCD in a coordinate plane and show that it is a parallelogram.

A(-2, 3), B(-5, 7), C(3, 6), D(6, 2)

Answers

The quadrilateral is parallelogram, When the vertices of quadrilateral ABCD are given.

A parallelogram is a two-dimensional shape that has a pair of two parallel and congruent sides. It is the simplest type of quadrilateral that has opposite sides equal and parallel.

The opposite angles of a parallelogram are also equal and the sum of two consecutive angles is always supplementary. It has two unequal diagonals.

A point always represents the location of a particular place or position in a standard cartesian system, and the coordinates of the point represent the distances from the respective coordinate axis.

For example, consider a point P(x,y), in which the coordinates x and y are the perpendicular distances from the x-axis and the y-axis respectively.

The formula to find out the distance between two points is generally known as the Distance formula which can be expressed as:

d=√(x₂−x₁)²+(y₂−y₁)²

Given:

The vertices of the quadrilateral

A B C D: A(-2,3),B(-5,7),C(3,6), D(6,2).

The measure of the sides of the quadrilateral

d=√(x₂−x₁)²+(y₂−y₁)²

AB=√(-5-(-2))²+(7-3)²

Ab=√(-3)²+4²

AB=√25

AB=5units.

BC=√(3+5)²+(6-7)²

BC=√(8)²+1²

BC=√65 units.

CD=√(6-3)²+(2-6)²

CD=√3²+4²

CD=√25

CD=5 units.

AD=√(6-(-2))²+(2-3)²

AD=√(-8)²+1²

AD=√65 units.

The diagonals:

BC=√(3+5)²+(6-7)²

BC=√(8)²+1²

BC=√65 units.

AC=√(3+2)²+(6-3)²

AC=√(5)²+3²

AC=√25+9

AC=√34 units

Here, AB=CD and BC=AD and AC≠BC

Thus, the given quadrilateral is parallelogram.

To know more about Parallelogram:

https://brainly.com/question/29362382

#SPJ4

Solve the system of equations by multiplying first. Enter the solution as an ordered pair.
4x+8y=40
3x-2y = 14

Answers

Answer:

14

Step-by-step explanation:

Answer:

We can start by multiplying the first equation by 3:

12x + 24y = 120

Then we can multiply the second equation by 4:

12x - 8y = 56

Now, we have:

12x + 24y = 120

12x - 8y = 56

If we subtract the first equation from the second equation:

32y = 64

y = 64/24

y = 2

Now that we know the value of y, we can substitute it back into one of the original equations to find the value of x.

Let's use the first equation:

4x+8(2) = 40

4x+16 = 40

4x = 24

x = 24/4

x =6

So, the solution of the system of equations is x = 6, y = 2.

5 question

Directions: Read through Scenario and answer questions 1-15 using July’s Cost for Services fee schedule.

Scenario: July is self-employed and works as an esthetician. She does eyelashes, waxing services, brow lamination, facials and massages.

Answers

According to the information we can infer that July earns $675 per week (answer 1), $715 every weekend (answer 2); $5,560 per month (answer 3), $3,050 for additional services (answer 4), and $8,610 as a year's total (answer 5).

How much does July make per week (answer 1)?

To calculate how much does July make per week we have to take into account the following information:

Services that July currently make every week.

3 natural looks lashes2 volume lashes2 brow laminations2 full face waxing1 bikini wax

To calculate the total earned by July we have to multiply the price of each service by the number of customers of each one. Additionally, we have to add all results as shown in the following.

3 * $65 = $1952 * $85 = $1702 * $80 = $1602 * $45 = $901 * $60 = $60

$195 + $170 + $160 + $90 + $60 = $675

How much does July make on the weekend (answer 2)?

To calculate how much does July make per weekend we have to take into account the following information:

Services that July currently make every weekend.

2 body massages2 natural look lash extensions3 mega volume extensions2 facials

To calculate the total earned by July we have to multiply the price of each service by the number of customers of each one. Additionally, we have to add all results as shown in the following.

2 * $85 = $170

2 * $65 = $130

3 * $95 = $285

2 * $65 = $130

$170 + $130 + $285  * $130 = $715

How much does July make on a given month (answer 3)?

To calculate how much July makes on a given month we have to add the weekend earnings with week earnings and multiply it by four (taking into account that a month has four weeks).

$715 + $675 = $1,390

$1,390 * 4 = $5,560

How much would July make for additional services alone per year (answer 4)?

To calculate the total earned by July for additional services we have to calculate the total value of these services and multiply it by five.

2 * $185 = $370

3 * $80 = $240

$240 + $370 = $610

$610 * 5 = $3,050

How much would July make in a year for her regular services plus the additional services mentioned in question #4 (answer 5)?

To calculate how much would July make in a year for her regular services plus the additional services of the question 4, we have to add both values.

$5,560 + $3,050 = $8,610

Learn more about mathematics in: https://brainly.com/question/15209879

#SPJ1

68 8236 17 rounded of to 100​

Answers

Answer:

68823600

Step-by-step explanation:

Which relation is a function?

{(1, −7), (2, −8), (−2, 7), (1, 8)}
{(−2, 2), (−7, 7), (−1, 1), (−8, 8)}
{(−2, 1), (−2, 2), (−2, 7), (−2, 8)}​
{(−2, 1), (−7, −1), (2, 8), (−7, −8)}

Answers

The second relation is a function

Select three options. The value of f(–10) = 82 The graph of the function is a parabola. The graph of the function opens down. The graph contains the point (20, –8). The graph contains the point (0, 0).

Answers

The three (3) true statements about the quadratic function and its graph include the following:

A. The value of f(–10) = 82

B. The graph of the function is a parabola.

D. The graph contains the point (20, –8).

How to determine the true statements about this quadratic function?

Generally speaking, the graph of a quadratic function would always form a parabolic curve because it is a u-shaped. For this quadratic function, the graph is a upward parabola because the coefficient of x² is positive and the value of "a" is greater than zero.

Next, we would determine the other true statements about the graph of this quadratic function:

At point (-10, 82), we have:

Quadratic function, f(x) = 1/5 x² – 5x + 12

Quadratic function, f(x) = x²/5 – 5x + 12

Quadratic function, f(-10) = -10²/5 – 5(-10) + 12

Quadratic function, f(-10) = 82

At point (20, -8), we have the following:

Quadratic function, f(x) = 1/5 x² – 5x + 12

Quadratic function, f(x) = x²/5 – 5x + 12

Quadratic function, f(20) = 20²/5 – 5(20) + 12

Quadratic function, f(20) = -8

In conclusion, we can logically deduce that the graph of this quadratic function does not contain the point (0, 0) as shown in the image attached below.

Read more on quadratic function here: https://brainly.com/question/13159926

#SPJ1

Complete Question:

Consider the quadratic function f(x) = 1/5x² – 5x + 12. Which statements are true about the function and its graph? Select three options.

The value of f(–10) = 82

The graph of the function is a parabola.

The graph of the function opens down.

The graph contains the point (20, –8).

The graph contains the point (0, 0).

You have a set of cards labeled one through ten. Event A is drawing an odd card. Event B is drawing a four or higher. What is the P (A∩B)0.900.700.200.50

Answers

The value of probability P(A ∩ B) = 3/10 = 0.3.

Probability is a measure of the likelihood of a particular event occurring. It is expressed as a number between 0 and 1, where 0 indicates that an event is impossible and 1 indicates that an event is certain to occur.

Probability is used in many fields such as statistics, finance, economics, and science to make predictions and decisions based on uncertain information

Event A is drawing an odd card, which means that the odds are 5/10 or 1/2.

Event B is drawing a four or higher, which means that the odds are 7/10.

Event A ∩ B means that we are interested in the probability of drawing an odd card and drawing a card of four or higher at the same time. There are 3 cards that are both odd and four or higher, which are 5,7, and 9. So the probability of drawing one of these cards is 3/10.

Therefore, The value of probability P(A ∩ B) = 3/10 = 0.3.

To know more about probability refer to:

brainly.com/question/11234923

#SPJ4

which segment is the shortest​

Answers

Answer:  X or Y

Step-by-step explanation:

Other Questions
aamc 2022 free practice exam bbquestion a particular diploid organism is heterozygous in each of 3 unlinked genes. considering only these 3 genes, how many different types of gametes can this organism produce? Ah, happy, happy boughs! that cannot shed Your leaves, nor ever bid the Spring adieu; And, happy melodist, unwearied, For ever piping songs for ever new Write two to four sentences comparing the themes of the two poems. Use evidence from the texts to support your answer. The Cold War 4. Why is this sporting event (in the light of the Cold War conflict)? 8.why is it impossible for bruno to understand what is going on around him, even when shmuel tries to explain it to him? 30 POINTS ASAP America at the Turn of the Centuryadapted from the Library of Congress By 1900 the American nation had established itself as a world power. The West was won. The frontier was no more. The continent was settled from coast to coast. Apache war chief Geronimo had surrendered in 1886. Defeat of the Sioux at the battle of Wounded Knee in 1891 had brought the Indian Wars to a close. By 1900 American Indians were on reservations and the buffalo were gone. Homesteading and the introduction of barbed wire in 1874 had brought an end to the open range. The McCormick reaper had made large-scale farming profitable. In 1900, the U.S. was by far the world's largest agricultural producer. The first transcontinental rail link had been completed in 1869. Three decades later, in 1900, the nation had 193,000 miles of track, with five railroad systems spanning the continent. The world's first oil well had been drilled in Titusville, Pennsylvania, in 1859. By 1900, major oil fields were being tapped in Kansas, Illinois, Louisiana, Oklahoma, and Texas. The supply of American oil seemed limitless. John D. Rockefeller's Standard Oil Trust dominated the world's petroleum markets. It controlled more than 90 percent of the nation's refinery capacity. At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced. In the 1880s Andrew Carnegie had constructed the world's largest steel mill in Pittsburgh, Pennsylvania. By 1900, the United States was the largest steel producer in the world, turning out 10,000,000 tons a year. Henry Ford had built his first gasoline engine car in 1892 and the world's first auto race was held in Chicago in 1896. With the founding of the Ford Motor Company in 1903, the age of the automobile was underway. By 1900, telephones were in wide use. Cities were being electrified. Moving pictures were a curiosity. Guglielmo Marconi was conducting experiments that would lead to the development of the radio, and the Wright brothers were at work on a heavier-than-air flying machine. Cities were growing. New wealth and devastating fires produced a boom in urban construction. Architects Richardson, Hunt, McKim, Mead, and White flourished. Sullivan pioneered the skyscraper and his protg, Frank Lloyd Wright, was beginning his career in Chicago. This was a time of both confidence and ferment. In the cities and the states, political "Progressives" were coming to power, experimenting with reforms such as women's suffrage, direct election of United States senators, the initiative, recall, the Australian ballot, primary elections, and laws setting minimum wages, work standards, and regulated rates for common carriers and services. Followers of the Progressive movement believed in the perfectibility of man and his society. Republican William McKinley of Ohio was elected president in 1896 and re-elected in 1900. He had been preceded by Democrat Grover Cleveland. McKinley looked every inch a president. Young reporter William Allen White said of him after an interview: "He was the statue in the park speaking." A dignified, reserved man, McKinley was the last of the old-style, low-key presidents. McKinley was the last of five Civil War veterans to serve in the White House, signaling the end of the post-war era. He was also the fifth of the six Ohio presidents to serve during the fifty-year period 1868-1908. McKinley is generally considered to have been a good but weak man. He would be followedand overshadowedby Theodore ("Teddy") Roosevelt, who was vice-president when McKinley was assassinated in 1901. Later, Roosevelt would be elected president in his own right. The ascendancy of Ohio and the Midwest in national politics demonstrated that the United States was no longer a nation oriented to the Atlantic seaboard. It stretched, as the anthem, America the Beautiful, put it, "from sea to shining sea."Select all the correct answers.Read the sentence from "America at the Turn of the Century."At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced.Which three sentences correctly paraphrase the sentence?A. A nation's industry was considered powerful by the number of tons of steel it produced (Library of Congress). B. In the late 19th century, it was the amount of steel produced that showed how powerful a nation's industry was (Library of Congress). C. A nation's industry was considered powerful only if it managed to produce a large quantity of steel (Library of Congress). D. At the turn of the century, the number of tons of steel helped determine the strength of a nation (Library of Congress). E. The quantity of steel produced helped determine the strength of a national industry (Library of Congress). which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge? ache mothers, in paraquay, carry their young children almost all the time to protect them from getting hurt in the forest. consequently, their children walk almost a year later than american children. based on this example, do you think it is the impact of nature, nurture, both or neither that influenced this cultural difference? You develop and deploy several microservices to an Azure Kubernetes Service (AKS) cluster. The microservices are instrumented with the Application Insights SDK. You configure an Application Insights instance and use the connection string in the instrumentation.The instrumentation includes a custom telemetry value used to track the order checkout action. Order checkout is an action that includes a property to capture the order number.You need to capture the custom order telemetry.Which Application Insights data type should you use?Select only one answer.tracedependencymetricevent Otis wants to borrow 10000 to buy a used car. he examined his budget and decided that he can afford a payment of $200 a month. if his bank offers him a rate of 7.5%, how long should he borrow the money so he can afford his monthly payment? two harmonic waves are described by y1= (4m) sin (8/mx-300/s t) y2=(4m) sin (8/mx-300/s t-2) what is the wavelength of the resultant wave ? Below you will find the yearly average values of the Dow Jones Industrial Average, the most popular index of stock market prices, for five different years. The Consumer Price Index for each year (on a base of 1982- 1984 = 100) can be found on the inside back cover of this book. Use these numbers to deflate all five stock market values. Do real stock prices always rise every decade?Year Dow Jomes Industrial Average1970 7531980 8911990 2,8792000 10,7352010 10,663 DXL Practice with algebrai XDL | Identify equivalent in X Q Algebra It A Common Cor X DAt the start of the softball x GIdentify equivalent linear Xbd.com/math/grade-7/identify-equivalent-linear-expressions-word-problems?signinRedirect=https%3A%2F%2Fwww.ixl.com%2Fsignin%2 R.23 Identify equivalent linear expressions: word problems KWH>120xx + 1.2xSubmitAlec's parents give him x dollars per month for his allowance. However, since his birthday isin February, he gets an extra 20% bonus that month.Pick all the expressions that represent how much Alec's allowance is in February.x + 0.2x+1.2x*DX Consider the deflection (based on choices of E and I) and the weight of the material. How would you find a balance between the needed structural performance and weight? what decreases the possibility that errors will be caught and the potential for fraud will be increased? The measure of angle JKL is 145.The measure of angle MKL is 60.The measure of angle JKM is x.Find the value of x.X=0X5XK145M60D the dominican republic has 10.7 million people and a national population growth rate of 1.5 percent. paraguay has 6.8 million people and a national population growth rate of 1.5 percent. in how many years will each country double in size? sean is one of several general partners who own pints and cans, a small chain of bar and grills located in illinois and indiana. sean is interested in converting the partnership into a master limited partnership. if he convinces other partners to go along with his idea, pints and cans will select one: a. offer shares of ownership that are traded on a stock exchange much like a corporation. b. pay its taxes like a corporation. c. begin to operate much like a sole proprietorship. d. have to change its name to include the term ltd. in its title to indicate its owners have limited liability. this tissue type can perform absorption or secretion in the body. Culture is taught formally and informally. Identify the following sources as providing either formal or informal instruction. Did the Filipinos benefit from the political changes that the Spaniards introduced?