Jamar is attempting to factor the expression 15x^2-16x-15. In his first step, he rewrites the expression as 15x^2-25x+9x-15. Which of the following statements in true about Jamar’s work?

A. Jamar's first step is correct. He should continue to factor the expression.
B. The two middle coefficients add to the correct number, but do not multiply to the correct number.
C. The two middle coefficients multiply to the correct number, but do not add to the correct number.
D. The two middle coefficients do not add or multiply to the correct number.

Answers

Answer 1

Jamar's first step is correct. He should continue to factor the expression. Then the correct option is A.

What is a factorization?

It is a method for dividing a polynomial into pieces that will be multiplied together. At this moment, the polynomial's value will be zero.

Jamar is attempting to factor the expression 15x² – 16x – 15.

In his first step, he rewrites the expression as 15x² – 25x + 9x – 15.

Jamar's first step is correct. He should continue to factor the expression.

Then the correct option is A.

More about the factorization link is given below.

https://brainly.com/question/6810544

#SPJ1


Related Questions

im in summer school and i need to pass this please help me

Answers

g(x) is a shift of 8 units to the left and 4 units of f(x), then the correct statement is B.

Which statement compares the graph of the two functions?

First, a vertical shift of N units is written as:

g(x) = f(x) + N

if N > 0 the shift is upwards.If N < 0 the shift is downwards.

A horizontal shift of N units is written as:

g(x) = f(x + N).

if N < 0, the shift is to the right.If N > 0, the shift is to the left.

In this case, we have:

g(x) = f(x + 8) + 4

So g(x) is a shift of 8 units to the left and 4 units of f(x), then the correct statement is B.

If you want to learn more about translations:

https://brainly.com/question/24850937

#SPJ1

answer both questions please

Answers

Answer: The two imaginary solutions with rational coefficients are +/- 4i and the two imaginary solutions with irrational coefficients are +/- 1.414213562i.

Step-by-step explanation:

I would recommend using pascal's triangle to solve this problem.

*Note: This is more of a quick answer, I can show a detailed step-by-step procedure if you need, just comment.

factorise
answer is (a+c) (ca-b²)​

Answers

Answer:

Step-by-step explanation:

The geometric sequence graphed shows the number of mold spores in a Petri dish per day (please help!)

Answers

Answer:

f(1) = 2

f(n) = 2 × f(n - 1) , n ≥ 2

Step-by-step explanation:

the point of coordinates (1 , 2) is on the graph

Then

f(1) = 2

…………………………

We notice that :

f(2) = 4

f(3) = 8

f(4) = 16

16/8 = 8/4 = 4/2 = 2/1 = 2

________________________

This means the common ratio

of the geo sequence = 2

Hence ,

f(n) = 2 × f(n - 1)

Answer: f(n) = 2 × f(n - 1) , n ≥ 2

Step-by-step explanation:

This year, a small business had a total revenue of $40,700. If this is 26% less than their total revenue the previous year, what was their total revenue the previous year?

Answers

26% less than a value is best found by multiplying by (100 - 26)% = 74% = 0.74
So previous year x 0.74 = 40,700
Previous year = 40,700 / 0.74 = $55,000


What is the measure of angle AFR?
O 124 degrees
O 91 degrees
O 13 degrees
O 117 degrees

Answers

Answer:

13°

Step-by-step explanation:

AFR = VFN (opposite angle rule)

7x + 33 = 9x + 7

33 - 7 = 9x - 7x

26 = 2x

x = 26 : 2

x = 13°

-----------------

check

7 * 13 + 33 = 9 * 13 + 7   (remember PEMDAS)

91 + 33 = 117 + 7

124 = 124

the answer is good

Identify the value of a and the length of each secant segment.

Answers

x=  10, NL= 8 , NP = 12

What is secant?

A secant is a line that intersects a curve at a minimum of two distinct points.

Using secant theorem,

NL* NM = NP* NO

(3+5)*3 = (2+x)*2

24=  (2+x)*2

12= 2+x

x= 12-2

x= 10

So, NP= 2+x

     NP = 12

Learn more about this concept here:

https://brainly.com/question/12775317

#SPJ1

Which of the following points is NOT visible if the viewing window of a graphing utility is set at:
Xmin : 6
Xmaz: 6
Ymin : —6
Ymaz : 6

Answers

The points D(-7, 5), E(-8, -3), and H(10, -5) will not be visible the answers are D, E, and H.

What is graphing utility?

A graphing calculator is a portable computer that can plot graphs, solve multiple equations at once, and carry out other variable-related activities.

We have points shown in the coordinate plane.

As the window of a graphing utility is set at:

X(min) : -6

X(max): 6

Y(min) : -6

Y(max) : 6

The points out of 6 will not be visible.

We can draw a square as shown in the attached picture.

The points D(-7, 5), E(-8, -3), and H(10, -5) will not be visible.

Thus, the points D(-7, 5), E(-8, -3), and H(10, -5) will not be visible the answers are D, E, and H.

Learn more about the graphing utility here:

https://brainly.com/question/1549068

#SPJ1

PLEASE HELP ASAP!!!!
The polar equation r=7sin(2θ) graphs as a rose.

What is the length of the petals of this rose?

Enter your answer in the box.

Answers

Answer:  7 units

============================================================

Explanation:

r = distance from the origin (0,0) to a point on the polar curve

To find the length of the flower petal, we need to max out r (i.e. get it as large as possible).

Recall that sin(x) maxes out at 1, so that also applies to sin(2θ) as well.

Therefore, r = 7*sin(2θ) maxes out at r = 7*1 = 7 and this is the length of each petal. Basically it's the number out front of the sine term.

The graph is shown below. To type the symbol θ into desmos, you need to type "theta" without quotes.

Domain and range of f(x)=3x^2-9x+8

Answers

The range of the function lies between (0,8) to (1.5,1.25).

What are domain and range?

Range and Domain. The range of values that we are permitted to enter into our function is known as the domain of a function. The x values for a function like f make up this set (x). A function's range is the collection of values it can take as input. After we enter an x value, the function outputs this sequence of values.

The given function is:-

f(x) = 3x² -9x + 8

The value of the range will be from (0,8) to ( 1.5,1.25). When we plot the graph of the function the value of the range lies between the points (0,8) to ( 1.5,1.25). The graph is attached with the answer.

The domain of the function will be all the values of the real numbers for the function ranges from ( 0, ∞ ).

Therefore the range of the function lies between (0,8) to (1.5,1.25).

To know more about Domain and Range follow

brainly.com/question/26098895

#SPJ1

Select all the correct answers.
Which expressions are equal to

Answers

Given the data from the question, the expressions that are equal to 10 are

10³ ⋅ 10²10 ⋅ 10 ⋅ 10 ⋅ 10 ⋅ 10

To determine the expressions that are equal to 10⁵, we shall evaluate the options given from the question.

How to evaluate (10⁴)¹

Recall

(Aᵐ)ⁿ = Aᵐⁿ

Thus,

(10⁴)¹ = 10⁴

How toevaluate 10³ ⋅ 10²

Recall

Aᵐ ⋅ Aⁿ = Aᵐ⁺ⁿ

Thus,

10³ ⋅ 10² = 10³⁺²

10³ ⋅ 10² = 10⁵

How to evaluate 1 / 10⁵

Recall

1 / Aᵐ = A⁻ᵐ

Thus,

1 / 10⁵ = 10

How to evaluate (10³)²

Recall

(Aᵐ)ⁿ = Aᵐⁿ

Thus,

(10³)² = 10

How to evaluate 10 ⋅ 10 ⋅ 10 ⋅ 10 ⋅ 10

Recall

Aᵐ ⋅ Aⁿ = Aᵐ⁺ⁿ

10 ⋅ 10 ⋅ 10 ⋅ 10 ⋅ 10 = 10¹⁺¹⁺¹⁺¹⁺¹

10 ⋅ 10 ⋅ 10 ⋅ 10 ⋅ 10 = 10⁵

SUMMARY

(10⁴)¹ = 10⁴

10³ ⋅ 10² = 10⁵

1 / 10⁵ = 10⁻⁵

(10³)² = 10⁶

10 ⋅ 10 ⋅ 10 ⋅ 10 ⋅ 10 = 10⁵

From the above illustrations, only 10³ ⋅ 10² and 10 ⋅ 10 ⋅ 10 ⋅ 10 ⋅ 10 are equal to 10⁵

Complete question

See attached photo

Learn more about induce:

https://brainly.com/question/170984

#SPJ1

Which point has coordinates (5,-7pi/6)?

Point A
Point B
Point C
Point D

Answers

The answer is Point C

What is this Simplify as √16y¹6

Answers

Answer:

[tex]6y^1^6[/tex]

Step-by-step explanation:

I hope this has Helped :)

The diagonals of parallelogram abcd intersect at point e. to prove that bae= dce, all of the following could be used, except for which

a.the sum of measures of the interior angles of abcd is 360 degrees
b. abc = cda by sss
c. abc = cde by sss
d. given two parallel lines by transversal, alternates interior angles are congruent.

Answers

The only option that cannot be used to prove that the diagonals of parallelogram abcd intersect at point e is; Option C

How to determine quadrilateral proof?

A) The sum of the interior angles of any quadrilateral is 360° and so this is true about the parallelogram.

B) AB = CD and BC = DA from opposite sides of a parallelogram are equal. Also AC = CA because of reflexive property of congruence. Thus, ∠ABC ≅ ∠CDA

C) This is not true because ∠ABC ≅ ∠CDA instead of ∠ABC ≅ ∠CDE.

D) This is true because of the definition of a transversal.

Read more about proof of quadrilateral at; https://brainly.com/question/27846700

#SPJ1

The two dot plots below compare the forearm lengths of two groups of schoolchildren:

Two dot plots are shown one below the other. The title for the top dot plot is Forearm Length, Group A and the title for the bottom plot is Forearm Length, Group B. Below the line for each dot plot is written Length followed by inches in parentheses. There are markings from 9 to 12 on each line at intervals of one. For the top line there are 3 dots above the second mark, 4 dots above the third mark and 3 dots above the fourth mark. For the bottom line there are 3 dots above the first mark, 5 dots above the second mark, and 2 dots above the third mark.

Based on visual inspection of the dot plots, which group appears to have the longer average forearm length?

Group A, because seven children have a forearm length longer than 10 inches
Group B, because two children have a forearm length longer than 10 inches
Group A, because one child in the group has the least forearm length of 9 inches
Group B, because three children in the group have the least forearm length of 9 inches

Answers

Answer:

Group A, because seven children have a forearm length longer than 10 inches

Step-by-step explanation:

Create the dot plots based on the given information (please see attached images).

Group A = blue dots

Group B = red dots

From inspection of the attached dot plots, we can see that Group A appears to have the longer average forearm length.  This is because 7 children have a forearm length of longer than 10 inches.

To calculate the average forearm length, sum all data values and divide by the total number of data values.

[tex]\textsf{Average of Group A}=\dfrac{ 3 \times 10 + 4 \times 11 + 3 \times 12}{10}=11[/tex]

[tex]\textsf{Average of Group B}=\dfrac{ 3 \times 9 + 5\times 10+ 2\times 11}{10}=9.9[/tex]

Thus proving that Group A has the longer average former length.

According to given text data

Average of both groups

A:-

10(3)+11(4)+12(3)/1030+44+36/1066+44/10110/1011

B:-

9(3)+5(10)+11(2)/1027+50+22/1049+50/1099/109.9

Group A has bigger average

What is 10 1/2÷214 ?

Answers

Answer:

21/428 or 0.04 906542056074...

Step-by-step explanation:

Hi, please help me find the volume of this sphere :)

Answers

Answer: 8788

Step-by-step explanation:

Use the formula and use 3 for pi

13cm is the radius

[tex]13^{3\\[/tex] = 2197

2197 x 3 = 6591

6591 x 4/3 = 8788

Select the correct answer from each drop-down menu. (Will give brainliest)


(Picture below options are 19.5, 29, 58 for both multiple choice)

Answers

The angle BAC will be 29 and the angle BOC will be 58.

What is the circle theorem?

The angle in a circle's centre is twice that at its perimeter when two angles are subtended by the same arc. So, angle AOB = 2 angle ACB. Angles that the same arc subtends at its circumference are equal. As a result, angles inside a section are equal.

Here the given angle is ∠BDC = 29 so from the given theorem the angle BEC will be equal to the angle BDC.

∠BDC = 29

The centre angle BOC will be twice the angle at the circumference so the angle will be twice.

∠BOC = 59

Therefore the angle BAC will be 29 and the angle BOC will be 58.

To know more about the circle theorem follow

https://brainly.com/question/26594685

#SPJ1

The fences will be aligned with the exterior angles 1 and 2. what are some other relationships you can see between 1,2,a, and b? (2 points)

please help


1.8.4

Answers

The relationships between angles 1, a, b, and 2 can be defined using the angles between parallel lines.

In the diagram, we can see the fences, making angles 1 and 2 with the parallel lines X and Y respectively.

Using the angles among parallel lines, we can state the relationships between angles 1, a, b, and 2 as follows:

Angle 1 and Angle a are adjacent angles, thus their sum is 180°, that is m∠ 1 + m∠ a = 180°.Angle 2 and Angle b are adjacent angles, thus their sum is 180°, that is m∠ 2 + m∠ b = 180°.Angle 1 and Angle b are corresponding angles, thus they are equal, that is m∠1 = m∠ b.Angle 2 and Angle a are corresponding angles, thus they are equal, that is m∠2 = m∠ aAngle 1 and angle 2 are co-exterior angles, thus their sum is 180°, that is, m∠ 1 + m∠ 2 = 180°.Angle a and angle b are co-interior angles, thus their sum is 180°, that is, m∠ a + m∠ b = 180°.

These were the relations among angles 1, a, b, and 2, using the parallel lines X and Y.

Refer to the diagram for a better understanding.

Learn more about angles in parallel lines at

https://brainly.com/question/24868078

#SPJ4

46. Geometry The volume of a cube is a function of the length of a side of the cube. Write a function for the volume of a cube. Find the volume of a cube with a side 13.5 cm long.​

Answers

Answer:

1/3×22/7×r^2h

Step-by-step explanation:

the volume =1/3 ×22/7×r^2×13.5

Each statement describes a transformation of the graph of y= x. Which statement correctly describes the graph of y= x+ 9.5?

a. it is the graph of y= x where the slope is increased by 9.5 .

b. it is the graph of y= x translated 9.5 units to the right.

c. it is the graph of y= x translated 9.5 units up.

d. it I'd the graph of y= x translated 9.5 units down.

Answers

Answer: C

Step-by-step explanation: The graph is going to go up because the +9.5 isn't in any parentheses. If it was, that would mean it would move horizontally. I hope this helps!

The correct statement:

It is the graph of y = x translated 9.5 units up.

The correct option is c.

The equation y = x represents a straight line passing through the origin with a slope of 1. When we have the equation y = x + 9.5, it means that for every x-value, the corresponding y-value is obtained by adding 9.5 to the original x-value. This translation in the y-direction shifts the entire graph upward by 9.5 units.

To visualize this, imagine the original line y = x. Each point on this line has an x-coordinate and a corresponding y-coordinate, which are the same due to the equation y = x. When we add 9.5 to each y-coordinate, the line shifts vertically by 9.5 units without any change in slope or horizontal position.

The other options can be eliminated because the statement does not mention changing the slope or the horizontal position of the graph. Instead, it specifically describes a vertical translation, indicating a movement in the y-direction. Therefore, the correct answer is c.

To learn more about translation in geometry;

https://brainly.com/question/2373420

#SPJ2

Directions: Find the inverse of each number.

Additive

-2 =
18 =
-30 =
2/5 =

Multiplicative

8/9 =
12/15 =
-6 =
10 =

Answers

Answer:

Additive

-2 = 2

18 = -18

-30 = 30

2/5 = -2/5

Multiplicative

8/9 = 9/8

12/15 = 15/12

-6 = -1/6

10 = 1/10

Step-by-step explanation:

an additive inverse is a number you must add to another number to get 0

(think of it as the negative version of the number)

{but WHY? In math, you can imagine comparing numbers on a number line. If we are finding the opposite of a number, we want to find the same distance from 0, but on the opposite side of 0. So, 2 would be two to the right of 0, -2 would be two to the left of 0}

-2 + 2 = 0

18 - 18 = 0

-30 + 30 = 0

2/5 - 2/5 = 0

a multiplicative inverse is a number that you multiply by another number to get 1.

We are finding the "reciprocal" of a number; you are essentially flipping it as a fraction

(reciprocal of 2 = 1/2  {remember, 2 is the same thing as 2/1 }   ; reciprocal of 1 / 8 = 8)

note: reciprocal is being used interchangeably with multiplicative inverse here

8/9 · 9/8 = 1

12/15 · 15/12 = 1

-6 · -1/6 = 1                     {-6  = -6/1}

10 · 1/10 = 1                    {10 = 10/1}

hope this helps!! have a lovely day :)

Answer:

Additive: number that you add to get 0

2

-18

30

-2/5

Multiplicative: number that you multiply to get 1

9/8

15/12

-1/6

1/10

hope this is helpful!!  ^u^

this is not a right angled triangle, but how do i find the 3rd side of a triangle if one side is 50 and the other side is 30?​

Answers

Use the Pythagorean theorem.

What is
-8/15of21/12

Answers

32
——- (after reducing the fraction)
105
Explanation: find reciprocal of divisor:
21/12 : 12/21
Multiply dividend:
8/15 divide21/12=8/15x12/21=
8 x12
———= 96/315
15x21

Mike has 63 toys. 18 of them are new and 12 are his favorites, while 4 are new and favorites. Mike is giving away all the toys that are neither new nor favorites. How many toys does mike GIVE AWAY. ASAP ASAP

Answers

4 are new and favourites
14 are new but not favourites (18 - 4)
8 are favourites but not new (12 - 4)
This means 4 + 14 + 8 = 26 are either new or favourites
He will give away 63 - 26 = 37 toys

3. Use the following diagram to solve for x.

Answers

The value of x from the given diagram is -6

Lines and angles

Line is defined as the distance between two points. Given the line RP with the following measures

RP = 17

RQ = x + 14

QP = x + 15

Using the expression

RP = RQ + QP

Substitute

17 = x + 14 + x + 15

17 = 2x + 29

Determine the value of x

2x = 17 - 29
2x= -12

x = -6

Hence the value of x from the given diagram is -6

Learn more on lines here: https://brainly.com/question/6950210

#SPJ1

can someone please help and explain these problems ??

Answers

Answer:

AAA

Step-by-step explanation:

yesss

Find the HCF of
x^2 y and y^2

Answers

The highest common factor is [tex]\boxed{y}[/tex].

The loudness, L, measured in decibels (Db), of sound intensity, I, measured in watts per square meter, is defined as L = 10 log StartFraction I Over I 0 EndFraction, where I 0 = 10 Superscript negative 12 and is the least intense sound a human ear can hear. What is the approximate loudness of a dinner conversation with a sound intensity of 10–7?

Answers

The correct option is Option D: the approximate loudness of a dinner conversation will be 50Db with a sound intensity 10⁻⁷.

The loudness L, ( which is measured in decibels (Db)), of the sound of the intensity I, can be calculated in watts per square meter,

L = 10 log(I/I₀)  

where I₀ = 10⁻¹²  which is the least intensity that a human can hear.

The sound intensity of a dinner conversation= I= 10⁻⁷

Loudness L of that conversation = 10 log (10⁻⁷/10⁻¹²)

= 10 log(10⁻⁷⁻⁽⁻¹²⁾)

= 10 log(10⁻⁷⁺¹²)

= 10 log(10⁵)

= 10*5

= 50 Db

Therefore the correct option is Option D: the approximate loudness of a dinner conversation will be 50Db with a sound intensity 10⁻⁷.

Learn more about the sound intensity

here: https://brainly.com/question/17062836

#SPJ10

What are the solutions of x^2-3x+3=0

Answers

Therefore the solution to this equation is imaginary given by x = [tex]\rm \dfrac { 3 \pm \sqrt{-3}}{2}[/tex]

What is a Quadratic Equation ?

A Quadratic equation is an equation that can be written in the form of

ax² +bx+c = 0

The solution of the given quadratic equation

x² -3x +3 = 0

the roots of the equation is given by

[tex]\dfrac { -b \pm \sqrt{b^2 -4ac}}{2a}[/tex]

here a = 1 , b = -3 , c = 3

Substituting the values

The solution is

[tex]\rm \dfrac { 3 \pm \sqrt{(-3)^2 -4*1 *3}}{2}[/tex]

Therefore the solution to this equation is imaginary

given by

x = [tex]\rm \dfrac { 3 \pm \sqrt{-3}}{2}[/tex]

To know more about Quadratic Equation

https://brainly.com/question/2263981

#SPJ1

Other Questions
Problem 4 (a) three friends are packing sweets into gift boxes. they agree that each box should contain the same number of sweets, but they are each working in separate locations with their own pile of sweets so cannot share boxes. gwen has 286 sweets, bill has 390 sweets and zeta has 468 sweets. if they put the largest number of sweets into each box that they can and they use up all their sweets, how many boxes of sweets will they pack? (b) use the euclidean algorithm to find the highest common factor of 8008 and 24255 (you need to show all working). Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom why Germany was fertile soil for the Nazis following World War I? To learn by rote and imitation signifies: Group of answer choices Precomposed tradition Absolute Tradition Oral tradition Programmatic tradition three interior angles of a quadrilateral measure 55 , 117 , and 120. what is the measure of the fourth interior angle? Write a system of equations that could be used to solve the situation described below.You find 12 coins under the couch. Every coin is either a nickel or a penny, and they add up to a total of 32 cents. How many of each type of coin do you have? Let x represent the number of pennies and y represent the number of nickels.Please select the best answer from the choices providedA. x+y=12 0.05x+0.01y=0.32B. x+y=0.32 0.01x+0.05y=12C. x+y=12 0.01x+0.05y=0.32D. not enough information my guy friend is asking me if he dated a they/them, would that make him g.ay? If you was a trans male, I didn't know the answer and my friends were ghosting me, can anyone help? Rewrite the following expression X 9/7 Question 4 of 32How does surface-to-volume ratio relate to the size of a cell?O A. Small cells have a smaller surface-to-volume ratio thanlarger cells.OB. There is no relationship between surface-to-volume ratioand cell size.O c. Small cells have a greater surface-to-volume ratio thanlarger cells.O D. Surface-to-volume ratio remains constant as cells increasein size. In unit 5 you learned about the importance of using Close Reading strategies to improve your reading comprehension. During our FFU session, you were to Stop, Jot, and Share. For extra credit you can email me what you jotted down during the session. If you were unable to attend, please see the recording: Class Recording As always, please let me know if you have any questions. If you have 4 45 plates and a 45 pound bar how heavy is that In the diagram, point D divides line segment AB in the ratio of 5:3. If line segment AC is vertical and line segment CD is horizontal, what are the coordinates of point C? Diagram shows a line segment with endpoints A(2, minus 6) and B(10, 2). Point D lies on this line segment. A dashed segment extends up from point A until point C and then extends horizontally to right until point D, forming a right triangle. A. (2, -1) B. (2, -3) C. (5, -3) D. (7, -1) Reset Next true or false? if a population is identified to be high-risk for an untreatable condition, medical professionals have an ethical responsibility to screen individuals for the condition. Ribosomal subunits are large complexes composed of numerous polypeptides and at least one rrna molecule. Which subunits include three rrna molecules?. What happens to the atomic radius when an electron is gained?OA. The negative ionic radius is larger than the neutral atomic radiusB. The negative ionic radius is smaller than the neutral atomic radiC. The negative ionic radius is the same size as the neutral atomicradius.D. The negative ionic radius does not follow a trend with the neutraradius. What is the simplified form of StartRoot 144 x Superscript 36 Baseline EndRoot?12x612x1872x672x18 Even though they are moving into a more demanding situation socially and financially, why does the play end on a hopeful note?Select one:a. Travis is taking on more responsibilities to earn money.b. The family is more connected and determined.c. Buying a home illustrates an investment into the future both in term of family and finance.d. All of the abovee. Both B & C What reasons does Warren provide in this passage to support the claim? Select three options.The policy of segregation increases a sense of inferiority because it is a law.Racially integrated schools would have little impact on educational equality.Racially segregated schools take away educational benefits from African Americans.The policy of segregation makes African American children feel inferior.The policy of segregation has a negative effect on the education of white children. $50 item discounted 30% what is the goal of humanistic therapy?