Muzan Killed Tanjiro's family because of fear of Yoriichi and the most powerful breathing technique, Sun Breathing. That if he did not kill the kamado family they would use their sun breathing and kill muzan. But in this case Tanjiro and Nezuko survived and will later kill Muzan in the Manga, I think.

Answers

Answer 1

Answer:

UUM not a question but um can i get free brainliest?

Explanation:

Answer 2

Muzan is indeed afraid of Yoriichi's breathing technique, sun breathing. But did not kill Tanjiro's family for that reason. Due to Tanjiro's family being descendants of a close friend of Yoriichi who was taught Sun breathing techniques, Muzan targeted the only remnant of Yoriichi, Tanjiro's family. In the manga, (SPOILER): All the remaining demon slayers fight against Muzan and before the Sun rises, Muzan takes over Tanjiro who if he remained as a demon, would be immune to sunlight and the nichirin blade. But through the support of his friends, Tanjiro managed to mentally defeat Muzan, defeating him as a result. Everyone is eventually reincarnated.


Related Questions

The right-handed twin lives in the Sky-World and he is content with the world he helped to create. The left-handed twin lives in the world below. He, too, is content with the world of men. He delights in the sounds of warfare and suffering. These two beings rule the world and look after the affairs of men. During the day people have rituals to honor the right-handed twin. At night they dance and sing for the left-handed twin.

Based on this excerpt, it is reasonable to conclude that

Answers

Based on this excerpt, it is reasonable to conclude that Good and evil

How, explain your answer briefly?

The text says that the right-handed twin lives in the sky-world. Only what is good can live in the sky so we can conclude that the right-handed twin represents the good and the good things that are present in the world.

Soon after, the text informs that the left-handed twin delights with the sounds of war and suffering. Only a cruel and sickly person would delight in something so bad in humanity, and this shows that the left-handed twin represents evil.

The text passes the information that the two twins complete themselves in ruling the world and taking care of the affairs of men. This shows the balance between good and evil in the universe.

Thus, this could be the answer.

To learn more about, the two brothers click here:

https://brainly.com/question/8160179

#SPJ1

Select the correct answer.
Jamle's research question is: "How are substances found on the Moon different from those found on the Earth?"
Which quotation from the source provides the best Information to address this research question?
OA "Moon dust isn't like the stuff that collects on a bookshelf or on tables - It's ubiquitous and abrasive, and it
clings to everything."
OB. Lunar dust] clogged the camera equipment and scratched helmet visors so badly that astronauts had
difficulty seeing."
OC. "Here on Earth, particulate matter is a form of air pollution generated by forest fires, volcanic eruptions,
and burning fossil fuels."
OD. "The Canary-S... can measure a variety of pollutants, including particulate matter, carbon monoxide,
methane, sulfur dioxide, and volatile organic compounds."
L
Reset
Next
Sign out
6:22

Answers

The quotation from the source that provides the best information to address the given research question is as follows:

Here on Earth, particulate matter is a form of air pollution generated by forest fires, volcanic eruptions, and burning fossil fuels.

Thus, the correct option is C.

What is a Quotation?

A quotation may be defined as retribution or expression which is directly or indirectly carried from a book, poem, or play, which is recited by someone else.

The context of this question illustrates the differences in environmental factors of the moon and the earth distinctly.

It also expresses that Earth's surface consists of particulate matter which is a form of air pollution and is generated or provoked by the activities like forest fires, volcanic eruptions, and combustion of fossil fuels.

All such activities of inducing air pollution are significantly not seen on the surface of the moon.

Therefore, it is well described above.

To learn more about Air pollution on the earth, refer to the link:

https://brainly.com/question/9420026

#SPJ1

Answer:

A

Explanation:

"Moon dust isn't like the stuff that collects on a bookshelf or on tables - It's ubiquitous and abrasive, and it

clings to everything."

( c is incorrect)

Then she heard his step on the stair away down on the first flight, and she turned white for just a moment.

The phrase "she turned white for just a moment” is mainly used to show that Della

A)has very fair skin.
B)is afraid of Jim’s reaction.
C)is beginning to get an illness.
D)had become extremely angry.

Answers

Answer:

B) is afraid of Jim's reaction

Explanation:

That phrase is usually used to convey an emotion of fear. Basically the phrase means she went pale.

"to persuade my classmates that quantitative easing policies are the equivalent of a tax hike on all americans," is an example of.

Answers

Answer:

a specific purpose

Explanation:

PLEASE HELP ASAP!! WILL GIVE 25 POINTS + BRANLIEST!
Choose what to include in a book report. Select five options.

A short retelling of the story

author's name

title

biography of author

name of publisher

a statement about why you did or did not like the book

illustrator's name

Answers

A short retelling of the story; author's name; title; a statement about why you did or did not like the book; illustrator's name are the elements to be included in the book report.

What is a book report?

A report that contains a short summary of the book, which contains all the significant parts of the book and also reveal the theme and setting of the book, is known as a book report.

A book report also contains an opinion of the reader who has illustrated such report along with the correct title.

Hence, options A, B, C, F and G holds true regarding a book report.

Learn more about a book report here:

https://brainly.com/question/12900054

#SPJ1

Read the scenario about a formal discussion. reggie is acting as moderator for a group discussion about the marching band’s fall fundraiser. the students in attendance hope to raise enough money to travel to california and march in the rose parade. what can reggie can do to be a successful moderator? select three options. ask contributors questions in order to get clarification encourage all group members to contribute help focus the conversation on the best point of view provide an agenda that helps keep the discussion on track use the meeting to share other experiences with fundraising

Answers

Answer: ask… clarification

Help… point of view
provide… on track

Explanation: took the test on edge

Answer:

ACD

Explanation:

What does this mean?
"Engages actively, demonstrating sound understanding of
key concepts in all curriculum areas. However, it is
important that she submits her assignments in a timely
manner."

Answers

Answer:

Based off of my interpretation, I'm assuming that "she" (whoever she may be) must take the time to learn and show a deep understanding of different topics within the course. However, she must also submit all assignments on time.

Click to read the passage from Beyond the Wall: Essays from the Outside, by
Edward Abbey. Then answer the question.
What does the author use in this passage to support the idea that the dam
has ruined Glen Canyon?
OA. A cause and its effect
OB. A solution to a problem
OC. A description
OD. An exaggeration

Answers

The device used by the author in this excerpt to show that the Grand Canyon was ruined by the dam, is C. a Description.

How was the dam shown to have been ruined?

Edward Abbey in "Beyond the Wall: Essays from the Outside" described the way the Grand Canyon looked before and after the dam was constructed.

This description showed that before the dam, the Grand Canyon was much better than it became after the dam which proved that the dam runed the Canyon.

Find out more on the device used by the author at https://brainly.com/question/10585268.

#SPJ1

When you tell your audience about your personal experience with the topic, you are a. gaining the attention of the audience b. setting the mood and tone of your speech c. previewing the main points d. establishing your credibility

Answers

When you tell your audience about your personal experience with the topic, you are establishing your credibility. The correct option is d.

What is telling personal experience?

Telling personal experience is called a personal anecdote or a memoir. In this, the narrator tells about his personal experience or incident, that if non-fictional.

Thus, the correct option is d. establishing your credibility.

Learn more about personal experience

https://brainly.com/question/1477872

#SPJ1

Two of your brothers had a bitter quarrel just before you left home for school.write a letter to your father pointing out where both where at fault and requesting him to intervene

Answers

In writing the letter to your father, the steps to take to pointing out the issues and  intervene are:

Start first by  salutation and then telling your father how all of are doing in the first paragraph.The 2nd paragraph should tell the reason for writing, the issue of the fight and all that happened.The 3rd paragraph should conclude everything one need to say and it should contain the solution to ending the quarrel.

What is letter writing?

A letter is known to be a kind of written message that helps to pass out information on a given subject of discussion.

Note that by structuring your letter to the pattern written above, one can write a good letter to your father about the bitter quarrel.

Learn more about letter writing from

https://brainly.com/question/24623157

#SPJ1

What's the best definition of the word "midtown" in this sentence?

We took the bus to midtown to do some shopping.

Answers

Answer:

An area in the center of a town or city.

Explanation:

In that sentence the word "midtown" tends to mean "the center of the city or town".

MissSpanish

According to this excerpt, how has Odysseus changed over the course of his adventure?

Answers

Answer:

He has become more humble and patient in battle. under Poseidon's blows, gale winds and tons of sea. He values home and family more than personal glory.

Explanation:

hope it helps you and give me a brainliest

What are some language methods found in the quote “It’s sacred name and origin” from a Christmas Carol?

Stave 1, pg 4

Answers

Answer:

just look at the moon and go over the passes try to pass trhough ot its very easy and btw im

see more...

Which of the following best explains the message, or
theme, of the poem?
O The Soul, a inner part of a person, is easily
swayed by outside forces of society and
powerful people.
The Soul, a inner part of a person, is
stubbornly selective about whom she
chooses to spend time.
O The Soul, a inner part of a person, is ever-
changing with each new experience the
person has.

Answers

The option that best explains the message or the theme of the poem by Emily D. is: "The Soul, a inner part of a person, is stubbornly selective about whom she chooses to spend time. " (Option B)

What is a Theme?

A theme is the key message or principle that an author is communicating via their literary work or text.

The topic of the poem is "The Soul Selects it's own Society". In this poem, Emily explores how it is that the soul is self-reliant and strong enough to chose those that it wants to associate with.

Thus, it is correct to state that the option that best explains the message or the theme of the poem by Emily D. is: "The Soul, a inner part of a person, is stubbornly selective about whom she chooses to spend time. "

Learn more about themes at;
https://brainly.com/question/25336781
#SPJ1

From The Scarlet Letter , how does hester earn a living ?

Answers

Answer:

A Seamstress

Explanation:

In chapter 5-8, Hester lives in a cottage isolated from the rest of the community on the edge of town to avoid social scrutiny. She works as a seamstress

From The Scarlet Letter, Hester earns a living by sewing for the magistrates and wealthy villagers.

Where does Hester live?

Hester and her daughter Pearl reside on the outskirts of town. The majority of the plot takes place in Boston. This is where she committed her transgression, and where the pastor Arthur Dimmesdale must bear the consequences.

Her expertise as a seamstress allows her to sustain herself and Pearl. Her work is in high demand for apparel worn at formal events and among the town's fashionable women – for all occasions except weddings. Despite her reputation as a seamstress, Hester remains a social pariah.

Hester supports herself and Pearl by sewing for magistrates and rich locals using her stitching abilities. She also sews for the destitute as a charitable effort. Despite the fact that they live little, Hester's one splurge is the way she dresses Pearl. Hester creates crimson, intricately embroidered gowns for Pearl.

Learn more about Scarlet Letter here:

https://brainly.com/question/1523481

#SPJ2

what is the rhyming word of way ​

Answers

say, day, may, pray.

My uncle stopped smoking several years ago . ( for)

Answers

Uncle can stop smoking to help reduce the risk of untimely death that is attached to smoking.

What are the reasons for stoping smoking?

Smoking involves inhalation of harmful substances that can lead to damage of vital body organs.

Hence, it is stopped to reduce the risk and danger attached to it such as damage of lungs and heart.

Therefore,

Uncle can stop smoking to help reduce the risk of untimely death that is attached to smoking.

Learn more on smoking below,

https://brainly.com/question/1990312

#SPJ1

Why does Antony shake the Liberators' bloodied hands?

A. He wants to appear to be friends with them to save his own life.

B. He wants the Plebians to blame him, too, for Caesar's death.

C. He is thankful that he is free of Caesar's tyrannical reign.

D. He is looking them in the eye while he shakes, trying to decide which one is guilty.

Answers

Answer:

a) He wants to appear to be friends with them to save his own life.

Explanation:

Antony put out his hand to the people who were plotting against him so that he could learn their plan and take revenge at the right time.

What are the purposes of this movie poster? Check all
that apply.
to persuade people to see a movie
to inform people about different types of music
to sell a particular brand of top hat
to grab an audience's attention
to promote singing or dancing lessons

Answers

The purposes of this movie poster are:

To persuade people to see a movie, and to grab an audience’s attention.

What are the purposes of the poster?

This poster is an educational advertisement for a movie starring two well-known people. This poster's most likely objective is to convince people to see the movie. A film poster is a poster that is used to promote and advertise a film, especially in order to entice paying customers to see it in a theatre.

Studios frequently create a variety of posters with varying sizes and materials for domestic and foreign markets. Those who are fans of the actors will be moved to see the film after witnessing the cast. Another reason for this film is to capture the audience's interest. The charming graphics and cheerful faces are designed to get the attention of people.

To learn more about poster, visit:

https://brainly.com/question/25964758

#SPJ1

This textual evidence from "A Case in Antiquities for 'Finders Keepers" by John
Tierney supports which claim?
"The timing of Dr. Hawass's current offensive, as my colleague Michael Kümmelman
reported, makes it look like retribution against the Westerners who helped prevent an
Egyptian from becoming the leader of Unesco, the United Nation's cultural agency."
The United Nations need to define which countries can claim artifacts as their own.
Some countries may be misusing the right to have artifacts returned to their country of origin.
The issue of which artifacts belong to which country has caused unnecessary violence.
Laws need to be rewritten to reflect the issues with determining the country of origin for
artifacts.

Answers

Answer:

Laws need to be rewritten to reflect the issues with determining the country of origin for artifacts.

How do bonds generate income for investors?


Bonds depreciate in value.
Bonds protect investors from bankruptcy.
Bonds pay interest to the bank that sold the bond.
Bonds pay a specified amount to the investor at maturity.

Answers

The bond's investors earn interest payments while holding the bonds until they mature and generate money from them. hence option d.

What are bonds?

A bond is a sort of security used in finance where the issuer owes the holder debt and is required, depending on the terms, to repay the principal and interest on the bond at the maturity date. Interest is often paid at regular intervals.

Direct bond purchases are made by private investors with the intention of holding them till maturity and profiting from the income they accrue. Additionally, they could invest in a bond mutual fund or bond ETF (ETF).

Hence option D is correct regarding the generation of income from bonds.

Learn more about Bond:

https://brainly.com/question/19130320

#SPJ1

Answer:

d

Explanation:

Which propaganda technique does this passage use? plain folks scapegoat bandwagon glittering generalities

Answers

The propaganda technique that has been utilized in the given passage would be Glittering generalities. Thus, the correct option is D.

What is the Propaganda technique?

The propaganda technique may be defined as a literary strategy to influence public opinion for or against one sentiment or another.

The complete question is as follows:

Read the passage from Animal Farm.

"What is that gun firing for?" said Boxer.

"To celebrate our victory!" cried Squealer.

"What victory?" said Boxer. His knees were bleeding,

he had lost a shoe and split his hoof and a dozen

pellets had lodged themselves in his hind leg.

"What victory, comrade? Have we not driven the enemy

off our soil the sacred soil of Animal Farm?"

"But they have destroyed the windmill. And we had

worked on it for two years!"

"What matter? We will build another windmill. We will

build six windmills if we feel like it. You do not

appreciate, comrade, the mighty thing that we have

done. The enemy was in occupation of this very ground

that we stand upon. And now-thanks to the leadership

of Comrade Napoleon--we have won every inch of it.

Which propaganda technique does this passage use?

plain folksscapegoatbandwagonglittering generalities

According to the given excerpt, the manipulation or the false declaration that is produced through propaganda technique is the 'sparkling generalized statement' that can persuade the spectators or readers to acknowledge it.

Therefore, it is well described above.

To learn more about Propaganda techniques, refer to the link:

https://brainly.com/question/25836020

#SPJ1

Answer: D- glittering generalities

Explanation:

Briefly summarize the events in Book 10.Keep your summary under eight sentences but be sure to include all major events.

Answers

Answer:

Early in the morning, late at night (I will wait for you)

It don't even matter what time it is (I will wait for you

Explanation:

“Whatever goes upon four legs, or has wings, is a friend. And remember also that in fighting against Man, we must not come to resemble him. Even when you have conquered him, do not adopt his vices. No animal must ever live in a house, sleep in a bed, wear clothes, drink alcohol, smoke tobacco, touch money, or engage in trade. All the habits of Man are evil. And, above all, no animal must ever tyrannize over his own kind. Weak or strong, clever or simple, we are all brothers. No animal must ever kill any other animal. All animals are equal.” What literary devices/techniques are in this quote?

Answers

Answer:

Zoomorphism, Anthropomorphism, Allegory, Foreshadowing, Metonymy, Paradox, Satire, and Symbolism

Explanation:

(in order)

Zoomorphism - giving animalistic traits to someone human (such as calling someone a busy bee)

Anthropomorphism - giving human traits to non-human things (such as objects, animals, or the weather. this is the same as personification)

Allegory - is used throughout Animal Farm, allegory is having a deeper message than the words themselves (such as the Tortoise and the Hare)

Foreshadowing - when a detail or same-circumstance is said in the book before it actually happens. (leaving out key details that make the story the actual story. such as stating "never play with matches" in the first chapter  then later in the book someone plays with matches by a gas stove burning down an entire neighbourhood because the only firefighters were busy at a fundraiser that was for the said kid, playing with matches.)

Metonymy - is a form of symbolism, although a metonym doesn’t just symbolize something else, it comes to serve as a synonym for that thing or things — typically, a single object — embodies an entire institution.

Paradox - meaning beyond belief, is a statement that asks people to think outside the box by providing seemingly illogical — and yet actually true — premises.

Satire - writers use satire to make fun of some aspect of human nature or society — usually through exaggeration, ridicule, or irony.

Symbolism - is like Metonymy, only authors turn to tangible symbols to represent abstract concepts and ideas in their stories. symbols typically derive from objects or non-humans — for instance, a dove might represent peace, or a raven might represent death.

upon reviewing the 48 literary devices and terms (which include:)

1. Allegory

2. Alliteration

5. Anaphora

6. Anastrophe

7. Anthropomorphism

8. Aphorism

9. Archetype

10. Chiasmus

11. Colloquialism

12. Cumulative sentence

13. Dramatic irony

14. Euphemism

15. Exposition

16. Flashback

17. Foreshadowing

18. Frame story

19. Hyperbole

20. Hypophora

21. Imagery

22. In Medias Res

23. Irony

24. Isocolon

25. Juxtaposition

26. Litotes

27. Malapropism

28. Metaphor

29. Metonymy

30. Motif

31. Onomatopoeia

32. Oxymoron

33. Paradox

34. Personification

35. Point of view

36. Polysyndeton

37. Repetition

38. Satire

39. Simile

40. Soliloquy

41. Symbolism

42. Synecdoche

43. Tautology

45. Tmesis

46. Tone

47. Tragicomedy

48. Zoomorphism

only eight (8) fit the quote.

hope this helps:)

Pls answer these for me!

Answers

16. doesn’t grow
17. Has played
18. Has stopped
19. Will you play
20. Usually grow, haven’t grown
21. Has to
22. Must
23. Have to
24. Musn’t
25. Had to
26. Have to
27. Must

Do I indent in an essay

Answers

Answer:

Yes you do

Explanation:
It is proper

yes don’t forget to do it for every paragraph

cion: How does where you live or where you call home shape the person you are?

Answers

As we shape our regional area through biological changes and colonial activities, so we collectively define its identity; in turn, as set locations for life, and hubs for gathering and activity, these places piece concurrently our own person, and collective, identities.

How does a community shape a person?

Neighbourhoods with shared goods, values, beliefs and attitudes enable us to live better, strive for more and concentrate on the outcomes we're looking for, developing a feeling of belonging, acceptance, knowledge and inspiration.

Thus, this could be the answer.

To learn more about shape of the person click here:

https://brainly.com/question/8998676

#SPJ1

What is the purpose of the third stanza of "Auspex"?
It indicates another direction the poem could take.
It clearly indicates the poem’s theme.
It offers a solution to the problem introduced in the poem.
It contrasts the image of the birds from the first stanza.

Answers

Answer:

It contrasts the image of the birds from the first stanza.

It contrasts the image of the birds from the first stanza. The answer is option D.

What is the Meaning of the stanza?

A stanza is a gathered arrangement of lines inside a lyric, normally set off from different stanzas by a clear line or space.

Stanzas can have normal rhyme and metrical plans, however, stanzas are not entirely required to have either. a course of action of a specific number of lines, typically at least four, at times having a settled length, meter, or rhyme plot, shaping a division of a poem.

Like lines, there is no set length to a stanza or a request that all stanzas inside a ballad require to be a similar length. Nonetheless, there are names for stanzas of specific lengths: two-line stanzas are couplets; three-lines, tercets; four-lines, quatrains.usually set off from different stanzas by a clear line or space. Stanzas can have standard rhyme and metrical plans, however stanzas are not entirely required to have either.

The answer is option D.

To learn more about "Auspex" click Here:

https://brainly.com/question/12792362

#SPJ1

How did Merrick express his happiness to Sir Treves?
He musically beat out a rhythm into his pillow. He whistled all day long
He sang a nursery rhyme every morning.​

Answers

Merrick, to express his happiness, as musically beat out a rhythm into his pillow to Sir Treves.

Why was John Merrick called the Elephant Man?

Merrick suffered scoliosis from an early age, as well as cranial bone overgrowth, skin that protruded from his face, and an enlarged right arm. Due to the skin on his face, he earned the nickname "The Elephant Man."

Ashley Montage's 1973 book The Elephant Man, A Study in Human Dignity, published by Ballantine Books, deserves considerable praise for resurrecting interest in the tale.

As a result, option (a) he musically beat out a rhythm into his pillow is correct.

Learn more about on Merrick, here:

https://brainly.com/question/17252139

#SPJ1

What important statement or statements are made in the excerpt about the upper class world that Judy grew up in and that dexter aspires to join?

Answers

We can deduce here that the important statements that were made in the excerpt are:

Those in the upper classes only value surface appearances.Judy values only her desires because she is immature and self-absorbed.

What is the statement?

The statement refers to a group of sentences that form a piece of information that one writes or makes verbally. Statements are made to convey information.

Thus, we see that the above are the important statements made in the excerpt.

Other Questions
Please help! Will give the brainliest :) Read the excerpt from "The Crab That Played with the Sea.He went North, Best Beloved, and he found All-the-Elephant-there-was digging with his tusks and stamping with his feet in the nice new clean earth that had been made ready for him.Kun? said All-the-Elephant-there-was, meaning, Is this right?Payah kun, said the Eldest Magician, meaning, That is quite right; and he breathed upon the great rocks and lumps of earth that All-the-Elephant-there-was had thrown up, and they became the great Himalayan Mountains, and you can look them out on the map.He went East, and he found All-the-Cow-there-was feeding in the field that had been made ready for her, and she licked her tongue round a whole forest at a time, and swallowed it and sat down to chew her cud.Kun? said All-the-Cow-there-was.Payah kun, said the Eldest Magician; and he breathed upon the bare patch where she had eaten, and upon the place where she had sat down, and one became the great Indian Desert, and the other became the Desert of Sahara, and you can look them out on the map.He went West, and he found All-the-Beaver-there-was making a beaver-dam across the mouths of broad rivers that had been got ready for him.Kun? said All-the-Beaver-there-was.Payah kun, said the Eldest Magician; and he breathed upon the fallen trees and the still water, and they became the Everglades in Florida, and you may look them out on the map.Then he went South and found All-the-Turtle-there-was scratching with his flippers in the sand that had been got ready for him, and the sand and the rocks whirled through the air and fell far off into the sea.Kun? said All-the-Turtle-there-was.Payah kun, said the Eldest Magician; and he breathed upon the sand and the rocks, where they had fallen in the sea, and they became the most beautiful islands of Borneo, Celebes, Sumatra, Java, and the rest of the Malay Archipelago, and you can look them out on the map!Which details from the excerpt best support the conclusion that this story is about the creation of the world? Select two options.Things turn into geographical features of the Earth, such as the Himalayas, when the Eldest Magician blows on them.The Eldest Magician and the animals engage in conversations using language, which is an example of personification.The animals engage in activities that are typical of their species, such as the cow chewing its cud and the beaver building a dam.The author repeats foreign expressions such as "Kun" and "Payah kun" in the conversations between the Magician and the animals Explain how cache (SRAM) can support CPU pipelining. Gerald is constructing a line parallel to line l through point P. He begins by drawing line m through points P and Q. He then draws a circle centered at Q, which intersects line l at point N and line m at point S. Keeping the compass measure, he draws a congruent circle centered at point P, which intersects line m at point T.Which next step will create point R, such that when a line is drawn through points P and R, the line will be parallel to line l?Lines m and n intersect at point Q. A circle is drawn around point Q and forms point S on line m and forms point N on line l. Point P is also on line m. A circle is drawn around point P and forms point T on line m.Use the compass to construct a circle centered at Q through point P.Using the compass measure between points S and N, draw an arc to the right of line m, centered at T, intersecting the edge of circle P.Using the compass measure between points S and N, draw an arc above line l, centered at N, intersecting the edge of circle Q. Use the compass to construct a circle centered at P through point Q.Mark this and return 2.how are the amino acids formed from the codon in mutation #2 different from those formed from the original codon pattern. Which of the following is not a constitutional role of the president? (3 points) Which of these will complete the simple sentence?Mee Younga. was a great math student, but she did notenjoy her English classes as muchb. and Henry practiced for their duet for hoursAc. got sick right before the performance;however, she was able to complete her solonone of thesePlease select the best answer from the choices providedBd. none of these If 1 < a x , then the minimum value of [tex] \rm log_{a}(x) + log_{x}(x) [/tex] is ?PLEASE HELP!!!! how to solve superstition In the decade between 1882 and 1892, lynching rose in the South by an overwhelming 200 percent, with more than 241 black people killed. Lynching was used as a means of social control to terrorize and intimidate blacks. Which cultural myth was used to justify and legitimate the practice of white mobs lynching black people Juan is learning about like terms in his math class. He must check all the combinations below that are like terms which ones should he check What is the value of p? essay on depending on other countries very harmful to us James has $1500 to open a checking account. He can maintain a monthly balance of at least $1000. He plans to use the ATM four times per month at his local branch. He does not overdraft his account and plans to use direct deposit. He also plans to pay his bills online and he averages 8 bills per month. Bank Account Terms and Conditions James wants an account with the lowest fees. Which checking account would be best for James A recent order for 15,000 items of building supplies was composed of bolts and nails. Nails cost 5 cents each. The entire order arrived at an expense of 1500 dollars. If there were 2500 bolts, what is the cost of each bolt? Which factor contributed to European global exploration during the 15th to18th centuries? D 37 = 40D = Check your solution. 37 = 40 The boys (clean) the car. It looks new again. Problem 4 (a) three friends are packing sweets into gift boxes. they agree that each box should contain the same number of sweets, but they are each working in separate locations with their own pile of sweets so cannot share boxes. gwen has 286 sweets, bill has 390 sweets and zeta has 468 sweets. if they put the largest number of sweets into each box that they can and they use up all their sweets, how many boxes of sweets will they pack? (b) use the euclidean algorithm to find the highest common factor of 8008 and 24255 (you need to show all working). Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom