Name the marked angle in 2 different ways.
W
T
V
U

Answers

Answer 1

The marked angle can be named in two different ways as: ∠HFG and ∠GFH.

How to Name an Angle?

To name an angle, the letter representing the vertex would always be at the middle.

Given the angle marked in the image below, where F is the vertex, we can name the marked angle in two different ways with F at the center as:

∠HFG and ∠GFH

Thus, the two different ways to name the marked angle are:

∠HFG and ∠GFH.

Learn more about angles on:

https://brainly.com/question/25770607

#SPJ1

Name The Marked Angle In 2 Different Ways.WTVU

Related Questions

The scale on a map says 1 inch = 25 miles. If two towns are 3 1/2
apart on the map, what actual distance separates them?

Answers

Answer:

87.5 miles

Step-by-step explanation:

Distance between points = 3 1/2 × 25 = 87.5 miles

find the area of this shape

Answers

Answer:

Area of shape is 9.42 units²

Step-by-step explanation:

From the picture we observe:

1. The shape is 3 quarters of circle as one quarter is excluded (note the right angle);

2. The radius of the circle is 2 units.

Use area formula of circle to find the area of given shape:

A = πr², area of circle

A = 3πr²/4 = 3*3.14*2²/4 = 9.42 units², area of shape

Answer:

a = 4pi

Step-by-step explanation:

The formula of finding a area of a circle is "a = piR^2.

Replace the R with the radius which is 2 for this circle.

One third of all guitars that are sold in the shop is a Stratocaster, one fourth of them are Telecasters, and one fifth of them is a Les Paul. If Jamie goes and buys a guitar, what are the chances she gets a telecaster or a Les Paul?
A. 58%
B. 53%
C. 45%
D. 43%

Answers

The probability that Jamie buys a telecaster or a Less Paul is 45% or forty-five percent.

How to find out the probability?

1. Find the individual probabilities:

Probabilities to buy a telecaster:

1/ 4 = 0.25

Probabilities to buy a Les Paul:

1/ 5 = 0.2

2. Add the probabilities:

0.25 + 0.2 = 0.45

3. Multiply by 100:

0.45 x 100 = 45%

Learn more about percentage in: https://brainly.com/question/13450942

#SPJ1

Find the value of x which satisfies the following equation.
log2(x−1)+log2(x+5)=4

Answers

[tex]\quad \huge \quad \quad \boxed{ \tt \:Answer }[/tex]

[tex]\qquad \tt \rightarrow \: x = 3[/tex]

____________________________________

[tex] \large \tt Solution \: : [/tex]

[tex]\qquad \tt \rightarrow \: log_{2}(x - 1) log_{2}(x + 5) = 4[/tex]

[tex]\qquad \tt \rightarrow \: log_{2} \{(x - 1)(x + 5) \} = 4[/tex]

[ log (x) + log (y) = log (xy) ]

[tex]\qquad \tt \rightarrow \: ( x - 1)(x + 5) = {2}^{4} [/tex]

[tex]\qquad \tt \rightarrow \: {x}^{2} + 5x - x - 5 = 16[/tex]

[tex]\qquad \tt \rightarrow \: {x}^{2} + 4x - 5 - 16 = 0[/tex]

[tex]\qquad \tt \rightarrow \: {x}^{2} + 4x -21 = 0[/tex]

[tex]\qquad \tt \rightarrow \: {x}^{2} + 7x - 3x - 21 = 0[/tex]

[tex]\qquad \tt \rightarrow \: x(x + 7) - 3(x + 7) = 0[/tex]

[tex]\qquad \tt \rightarrow \: (x + 7)(x - 3) = 0[/tex]

[tex]\qquad \tt \rightarrow \: x = - 7 \: \: or \: \: x = 3[/tex]

The only possible value of x is 3, since we can't operate logarithm with a negative integer in it.

[tex]\qquad \tt \rightarrow \: x = 3[/tex]

Answered by : ❝ AǫᴜᴀWɪᴢ ❞

Look at the tree shown in the diagram. What is the bight of the tree rounded to the nearest tenth foot?

Answers

Answer:

Correct answer is B, 69.3 feet

Step-by-step explanation:

Since we have a 30°-60°-90° right triangle, the length of the longer leg is √3 times the length of the shorter leg, so the length of the shorter leg is 1/√3, or √3/3 times the length of the longer leg.

[tex]120( \frac{ \sqrt{3} }{3}) = 40 \sqrt{3} = 69.3[/tex]

graph the line through (1,1) with slope 3/2​

Answers

Answer:

y = (3/2)x - (1/2)

Step-by-step explanation:

The general structure of a line in slope-intercept form is:

y = mx + b

In this form, "m" represents the slope and "b" represents the y-intercept. You have been given the value of "m" (3/2). To find the value of "b", you should plug "m" into the equation in addition to the "x" and "y" values from the given point (1,1)

(1,1) ----> x = 1, y = 1

m = 3/2

y = mx + b                                <----- Slope-intercept form

y = (3/2)x + b                            <----- Plug (3/2) into "m"

1 = (3/2)(1) + b                           <----- Plug values into "x" and "y" from point

1 = (3/2) + b                              <----- Multiply (3/2) and 1

(2/2) = (3/2) + b                        <----- Change 1 into common denominator

(-1/2) = b                                  <----- Subtract (3/2) from both sides

Because you now have values for both variables, you can construct your final equation.

y = (3/2)x - (1/2)

Help with a composition of two functions! 20 pts for a solution!

Answers

The function (fog)(x) would be (x^4 + 10x² + 27). Also, the domain of (fog)(x) is all the real numbers.

What is a function?

The function is a type of relation, or rule, that maps one input to specific single output.

Given;

f(x) = x² + 2

g(x) =  x² + 5

so, to take the composition of f and g (fog) replace the x in f(x)  with g(x);

(fog)(x) = (x² + 5)² + 2

(fog)(x) = (x^4 + 25 + 10x² )+ 2

(fog)(x) = (x^4 + 10x² + 27)

Also, the domain of (fog)(x) is all the real numbers.

Learn more about function here:

https://brainly.com/question/2253924

#SPJ1

what is the slope of the line represented by the equation y = 4/5x -3?

Answers

Answer:

4/5

Step-by-step explanation:

Slope

    Slope y-intercept of a line: y = mx + b

Where m is the slope and b is the y-intercept.

 [tex]\sf y =\dfrac{4}{5}x-3\\\\\boxed{Slope = \dfrac{4}{5}}[/tex]

hi brainly user! ૮₍ ˃ ⤙ ˂ ₎ა

⊱┈────────────────────────┈⊰

[tex]\large \bold {ANSWER}[/tex]

[tex]\large \boxed { \large \sf \green{m = \frac{4}{5} }}[/tex]

[tex]\large \bold {EXPLANATION}[/tex]

This line is in slope-intercept form, y=mx+b, where m represents the slope and b represents the y-intercept.

So that we can conclude that the slope is 4/5.

How to solve this?? (-4)-(-8)+(-4)

Answers

(-4) - (- 8) + (- 4)
- 4 - (- 8) + (- 4)
- 4 + 8 + (- 4 )
- 4 + 8 - 4
= 0
(-4)-(-8)+(-4)
-4 + 8 - 4
4 - 4
=0

• 2 minus signs make a plus sign

Factoring using GCF 15cd + 30c^2d^2

Answers

Answer:

15cd(1 + 2cd)

Step-by-step explanation:

greatest common factor is 15cd

[tex]15cd*1 + 15cd*2cd\\= 15cd(1 + 2cd)[/tex]

The stock of Company A lost 2% today to $73.50. What was the opening price of the stock in the beginning of the day?

Answers

The opening price of the stock in the beginning of the day will be $75.

What is the percentage?

The quantity of anything is stated as though it were a fraction of a hundred.

The stock of Company A lost 2% today to $73.50.

Let x be the opening price of the stock in the beginning of the day.

Then the opening price of the stock in the beginning of the day will be

0.98 · x = 73.5

         x = 73.5 / 0.98

         x = $75

More about the percentage link is given below.

https://brainly.com/question/8011401

#SPJ1

y=x^2 -2x -3 im not sure how to solve this

Answers

Answer:

It is solved on a graph

Step-by-step explanation:

A quadratic graphical solution.

????????????????????

Answers

Answer:

[tex]\text{C.} \ \ \ {\left(\textit{AB}\right)}^{2} \ = \ \left(\textit{AC}\right)\left(\textit{AD}\right)[/tex]

Step-by-step explanation:

This problem uses the concept of the tangent-secant theorem which describes the relationship of the segments a secant line and a tangent line with the associated circle. This theorem is found as Proposition 36 in Book 3 of Euclid's Elements.

As shown in the figure attached below, segment AB (in blue) forms a tangent with the circle BCD and segment AD (in orange) is the secant where it intersects the circle at point C.

Furthermore, let two segments (in green) be drawn one from point C and point D.

To show that [tex]\triangle ABC[/tex] is similar to [tex]\triangle ADB[/tex], notice that both triangles share a common angle [tex]\angle BAC[/tex]. Additionally, by the alternate segment theorem, [tex]\angle ABC[/tex] is equal to [tex]\angle ADB[/tex]. Therefore, [tex]\angle ACB[/tex] is also equal to [tex]\angle ABD[/tex].

Hence, [tex]\triangle ABC[/tex] is indeed similar to [tex]\triangle ADB[/tex]. This implies the ratio of the sides of both triangles is the same. Particularly,

                                                  [tex]\displaystyle{\frac{AB}{AD} \ \ = \ \ \frac{AC}{AB}}[/tex].

Then, performing cross multiplication yields

                                             [tex]{\left(AB\right)}^{2} \ \ = \ \ \left(AC\right)\left(AD\right)[/tex].

Therefore, the product of the lengths of the secant segment and its external segment is equal to the square of the length of the tangent segment.

The table below shows the results of a screening program organized by Level 300 students of the department physiotherapy of the College Health Sciences of the University of Ghana. Complete the table and answer the questions below it using your understanding of probability and its applications to biomedical data.
True Diagnosis for presence of E. Coli

Test results Disease No Disease Total
Positive 35 15
Negative 10 60
Total

a. What is the efficiency of the test? 3 marks
b. What is the sensitivity of the screening kit? 3 marks
c. What is the specificity of the screening kit? 3 marks
d. What is the predictive value (PPV) of the test? 3 marks
e. What is the negative predictive value (NPV) of the test? 3 marks
(15 marks)
2. In double blinded randomized control trial for hypertensive patients attending Cocoa Clinic, thirty (30) 50-59-year-old were admitted into an intervention program for 6 weeks. During the trial, the average improvement in their systolic blood pressure was 15. The average improvement in systolic blood pressure in the general population of hypertensive patients is 20 with a standard deviation of 2.

i. What are the null and alternative hypotheses in this RCT? (2 marks)
ii. What tail is required in this test? (2 marks)
iii. What is the most appropriate statistical test for this study? (2 marks)
iv. State the assumptions of the test. (2 marks)
v. Test the above hypothesis using the appropriate statistical tool (7 marks)
Critical value =3.6

Answers

The correct answer is C because they are asking for the specific screening kit marks

Pandas: There is a well-studied panda population in Wuyipeng. In 1981 there were 25 pandas and the researchers determined that they had an annual population grows by 6.6% each year. Which of the following models correctly represents this data?

Answers

The equation that models the data on pandas is FV = 25(1.066)^t.

What models the data?

The formula for calculating future value of the pandas is:

FV = P (1 + r) ^n

FV = Future value P = Present value R = annual population growthN = number of years

FV = 25(1.066)^t

To learn more about future value, please check: https://brainly.com/question/18760477

#SPJ1

solve for x -
[tex]\bold{x {}^{2} + 5x + 6 = 0}[/tex]

ty! ~​

Answers

[tex] {x}^{2} + 5x + 6 = 0 \\ \\ {x}^{2} + 2x + 3x + 6 = 0 \\ \\ x(x + 2) + 3(x + 2) = 0 \\ \\ (x + 2)(x + 3) = 0 \\ \\ x + 2 = 0 \\ \\ x = - 2 \\ \\ x + 3 = 0 \\ \\ x = - 3.[/tex]

The value of x = -2 and -3 .

Answer:

hope it helps...

it has both co ordinate and factorization

vertical angles must : check all that apply
A. be complementary
B. have the same vertex
C. be congruent
D. be acute

Answers

Answer: B and C

Step-by-step explanation: For A, vertical angles can be complimentary or supplementary. For D, vertical angles can sometimes be acute but not always.

You invested $7,000 into a money market account for 10 years at an annual interest rate of 3%. How much is the accrued interest?

Answers

The total interest accrued is $2,407.41 if you invested $7,000 into a money market account for 10 years at an annual interest rate of 3%.

What is invested amount?

An investment is a payment made to acquire the securities of other firms with the intention of making a profit.

We are assuming the interest will be compounded annually

[tex]\rm A = P(1+\dfrac{r}{n})^{nt}[/tex]

Where A = Final amount

          P = Principal amount

          r  = annual rate of interest

          n = how many times interest is compounded per year

          t = How long the money is deposited or borrowed (in years)

We have:

P = $7000

r = 3% = 0.03

t = 10 years

n = 1

[tex]\rm A = 7000(1+\dfrac{0.03}{1})^{1\times10}[/tex]

After calculating:

A = $9407.41

I = A - P = 9407.41 - 7000 = $2,407.41

Thus, the total interest accrued is $2,407.41 if you invested $7,000 into a money market account for 10 years at an annual interest rate of 3%.

Learn more about the invested amount here:

brainly.com/question/16995381

#SPJ1


Complete the remainder of the
table for the given function rule:
y = ²x + 4
X-6 -3 03 3 6
y 0 [?] [] [] []

Answers

Answer: 2, 4, 6, 8

Step-by-step explanation:

Just plug x into the equation for each one.

x = -3

[tex]y=\frac{2(-3)}{3} +4\\y=\frac{-6}{3} +4\\y=2[/tex]

With this one, you can see it is a linear equation and for every increase of 3 on x, y in increased by 2.

x   -6   -3   0   3   6

y   0   2    4   6   8

The radius of a circle is 5 cm (to the nearest cm). What is the smallest value
that the circumference could have?

Answers

Answer: 31 cm.

explanation:

Given, Radius = 5 cm (near to)

this means the radius is near 5 cm. It can be 4.9, 4.99, 4.999.....or 5.01,5.001,5.001...... and so on.

So, the circumference of the circle is given by:-

Circumference = 2× [tex]\pi[/tex] × r

2 × 22/7 × 5    (for the smallest value, we'll consider r as 5 and then round off the circumference to the smallest value)

⇒ 220/7 ≈ 31.43 cm

rounding off to the smallest integer, we have

Circumference = 31 cm.

The smallest value that the circumference could have is 10 [tex]\pi[/tex]cm

Using Formula,

Circumference = 2 [tex]\pi \\[/tex] r

Radius = 5 cm

So, C = 2 [tex]\pi[/tex] 5

C = 10 [tex]\pi[/tex]cm

Therefore circumference is 10 [tex]\pi[/tex]cm.

To learn more about the circumference of circles, refer to :

https://brainly.com/question/2407529

#SPJ2


dollars per pint
pints per dollar.

Find the unit rates. If necessary, round your answers to the nearest hundredth.
$6.79 for 16 pints

Answers

Answer:

0.42 dollar per pint

2.36 pints per dollar

What are the values for y when x is 1, 3, and 5?
y = 3x + 10

Answers

When x=1 y=13 when x=3 y=19 and when x=5 y=25 you just plug the numbers in for x and solve

Answer:

13, 19, 25.

Step-by-step explanation:

y=3x+10

-------------

x=1, y=3(1)+10=3+10=13

x=3, y=3(3)+10=9+10=19

x=5, y=3(5)+10=15+10=25

Question 10 of 10
Rewrite the following linear equation in slope-intercept form. Write your
answer with no spaces.
v+2=4(x-3)
Answer here

Answers

y+2=4(x-3)
y+2=4x-12
y+2-2=4x-12-2
y=4x-14

||
Writing ratios for real-world situations
There are 3 red marbles and 8 blue marbles in a bag.

Answers

Answer:

3:11 or 8:11

Step-by-step explanation:

I think your missing some imformation! I'm guessing the ratio of picking a red marble is 3:8 while a blue marble is 8:3

How to do this please?️​

Answers

Step-by-step explanation:

Using dimensional analysis, let convert km to cm.

[tex] \frac{4cm}{1km} \times \frac{km}{100000 \: cm} [/tex]

Cancel out the km

[tex] \frac{4cm}{100000 \: cm} [/tex]

[tex] \frac{1}{25000 } [/tex]

So n= 25000

iii.

Dimensional Analysis

[tex] \frac{3 \: cm}{1 } \times \frac{km}{100000 \: cm} [/tex]

[tex] \frac{3 \: km}{100000} [/tex]

Or

[tex]0.00003 \: km[/tex]

Juan is learning about like terms in his math class. He must check all the combinations below that are like terms which ones should he check? 3x and x 1/4 and 0.5 -m and 8m -xy2 and 2xy2 y and y2 4xy and -5x2y m and n -7 and 6

Answers

Answer:

he should check

3x and x

1/4 and 0.5

-m and 8m

-xy2 and 2xy2

Step-by-step explanation:

Answer:

The answer is A B C D H

Step-by-step explanation:

Please help!
Julie wants to show that a quadrilateral with vertices J(2, 3), K(2,7), L(-2,7), M(-2,3) is a square. Using the distance formula, what should she find the length of each side to be?
8

4

3

2

Answers

Answer:

4 is the answer

Answer:

4 is the answer I believe

Question 19 of 40
Which of the following is the correct definition of an angle?
OA. A shape formed by two intersecting lines or rays
B. A shape formed by the intersection of two lines
C. A shape formed by two intersecting rays
D. A shape formed by two intersecting lines from a common point

Answers

The correct definition of an angle is D: A shape formed by two intersecting lines from a common point.

What is a line segment?

A line segment is extended infinitely in both directions whereas a 'ray' is a line segment that has one endpoint and extends infinitely in the other direction.

Now, an 'angle' is formed by two rays having a common end-point.

As the angle has a common endpoint,

Therefore it is not possible to form an angle by intersecting two rays having different endpoints.

Hence, option D is correct.

Learn more about line;

https://brainly.com/question/3455295

#SPJ1

What is [3-8]-(12÷3+1)²

Answers

Answer:

-30

Step-by-step explanation:

What is [3-8]-(12÷3+1)²

[3-8]-(12÷3+1)² =

[3 - 8] - (4 + 1)² =

-5 - (5)² =

-5 - 25 =

-30

Chico, California, hosts the annual Silver Dollar Fair.
In 2016, contestants competed in the Inaugural World Silver Dollar
Pancake Eating Championship, where they had 8 minutes to eat as
many one-ounce silver dollar pancakes as possible.

Answers

Answer: what is the question

Step-by-step explanation:

Other Questions
essay on depending on other countries very harmful to us James has $1500 to open a checking account. He can maintain a monthly balance of at least $1000. He plans to use the ATM four times per month at his local branch. He does not overdraft his account and plans to use direct deposit. He also plans to pay his bills online and he averages 8 bills per month. Bank Account Terms and Conditions James wants an account with the lowest fees. Which checking account would be best for James A recent order for 15,000 items of building supplies was composed of bolts and nails. Nails cost 5 cents each. The entire order arrived at an expense of 1500 dollars. If there were 2500 bolts, what is the cost of each bolt? Which factor contributed to European global exploration during the 15th to18th centuries? D 37 = 40D = Check your solution. 37 = 40 The boys (clean) the car. It looks new again. Problem 4 (a) three friends are packing sweets into gift boxes. they agree that each box should contain the same number of sweets, but they are each working in separate locations with their own pile of sweets so cannot share boxes. gwen has 286 sweets, bill has 390 sweets and zeta has 468 sweets. if they put the largest number of sweets into each box that they can and they use up all their sweets, how many boxes of sweets will they pack? (b) use the euclidean algorithm to find the highest common factor of 8008 and 24255 (you need to show all working). Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom why Germany was fertile soil for the Nazis following World War I? To learn by rote and imitation signifies: Group of answer choices Precomposed tradition Absolute Tradition Oral tradition Programmatic tradition three interior angles of a quadrilateral measure 55 , 117 , and 120. what is the measure of the fourth interior angle? Write a system of equations that could be used to solve the situation described below.You find 12 coins under the couch. Every coin is either a nickel or a penny, and they add up to a total of 32 cents. How many of each type of coin do you have? Let x represent the number of pennies and y represent the number of nickels.Please select the best answer from the choices providedA. x+y=12 0.05x+0.01y=0.32B. x+y=0.32 0.01x+0.05y=12C. x+y=12 0.01x+0.05y=0.32D. not enough information my guy friend is asking me if he dated a they/them, would that make him g.ay? If you was a trans male, I didn't know the answer and my friends were ghosting me, can anyone help? Rewrite the following expression X 9/7 Question 4 of 32How does surface-to-volume ratio relate to the size of a cell?O A. Small cells have a smaller surface-to-volume ratio thanlarger cells.OB. There is no relationship between surface-to-volume ratioand cell size.O c. Small cells have a greater surface-to-volume ratio thanlarger cells.O D. Surface-to-volume ratio remains constant as cells increasein size. In unit 5 you learned about the importance of using Close Reading strategies to improve your reading comprehension. During our FFU session, you were to Stop, Jot, and Share. For extra credit you can email me what you jotted down during the session. If you were unable to attend, please see the recording: Class Recording As always, please let me know if you have any questions. If you have 4 45 plates and a 45 pound bar how heavy is that In the diagram, point D divides line segment AB in the ratio of 5:3. If line segment AC is vertical and line segment CD is horizontal, what are the coordinates of point C? Diagram shows a line segment with endpoints A(2, minus 6) and B(10, 2). Point D lies on this line segment. A dashed segment extends up from point A until point C and then extends horizontally to right until point D, forming a right triangle. A. (2, -1) B. (2, -3) C. (5, -3) D. (7, -1) Reset Next true or false? if a population is identified to be high-risk for an untreatable condition, medical professionals have an ethical responsibility to screen individuals for the condition. Ribosomal subunits are large complexes composed of numerous polypeptides and at least one rrna molecule. Which subunits include three rrna molecules?.