Please tell me if they are wrong or not!!! I give brainliest!!!!

Please Tell Me If They Are Wrong Or Not!!! I Give Brainliest!!!!

Answers

Answer 1
What’s the sentence???

Related Questions

why might concepts of necessity and uselessness be important?​

Answers

Answer:

Explanation:

What do these details show the characters and their lives? It is important because it shows how they live every day and that they have a lot of money and would rather just stay inside.

which line from the medicine bag best illustrates martins conflict with grandpas arrival

Answers

Answer:

the answer is C

Explanation:

hoped this helped

According to The Riddle of the Rosetta Stone what detail helped scholars determine that the second Egyptian scription was a simpler form of Egyptian writing that had been created by "the people"? O The scholars had seen examples of it before written on rolls of papyrus, a writing material used by the Egyptians. O Since the scholars had already studied Egyptian languages, they recognized both the hieroglyphs and the demotic version. OThe Greek inscription, which had already been deciphered, explained how to translate each of the Egyptian passages. OSince only ancient Egyptians understood hieroglyphs, the scholars knew the second inscription had to be a simpler version of the first.​

Answers

Answer:

the first statement

Walking is not the most exciting form of exercise a person can take on for fitness. Yet
it is low impact and requires no fancy equipment. That makes walking a simple
activity for those new to exercise. Walking is less likely than other exercises to cause
injury to leg tendons and muscles. All it requires is a good pair of sneakers-no cables,
stylish outfits, or weights required. Of course, a person could increase the benefit of
a workout by adding weights or speed walking.
Explain whether the main idea is explicit or implicit in this paragraph. (5 points)
1)
It is explicit because it is directly stated in the paragraph.
2) It is explicit because it is not directly stated in the paragraph.
3) It is implicit because it is directly stated in the paragraph.
4) It is implicit because it is not directly stated in the paragraph,

Answers

Answer:

It is A/1.

Explanation: Explicit means the moral of the story is just given to you, implicit means you got to figure out the moral. Hopes this helps!

Answer:

1) It is explicit because it is directly stated in the paragraph.

Explanation:

Explicit Means directly stated

Implicit means the opposite

In the text you can see that the main idea is clearly pointed out.

To synthesize an idea, the information taken from two texts needs to be ____.
Different
None of these
Identical
Similar

Answers

Answer:

Similar

Explanation:

Fragments: Look at the original word groups below. One of them may be a fragment. If it is, choose the answer from the options that corrects the fragment. If none of the word groups is a fragment, choose "The original word groups are all complete sentences." Pets can make good gifts for children. If the gift giver chooses the pet carefully.

Answers

Answer:

The answer that corrects the fragment is "Pets can make good gifts for children if the gift giver chooses the pet carefully."

Explanation:

Fragments are disconnected sentences from their main idea normally by the misuse of a period or comma, The original groups of words given are two separated sentences, by deleting the period between them we can have a full idea that follows the structure of fist conditional where we have the if clause that represents the condition or hypothetical situation, and the result that's the main clause. by making this change we will stop having fragments and we will have a correct first conditional sentence.

Based on the title, what inference can you make after reading the passage “A beakers dozen”?

Answers

Answer: a baker’s dozen is 13

Explanation:

First, practice your speech on your own. Consider practicing your speech for friends or family members. After that you must present the speech to your teachers or class. Keep the following instructions in mind when preparing for the speech:

Be aware of the time limit of the presentation.
Know and understand the material that is being delivered.
Plan the delivery of every point in the speech.
Create notecards to help you remember the important information.
Also, consider the following practices when delivering a speech:

Speak naturally, clearly, and loudly enough that everyone can hear you.
Make eye contact with various people in the audience.
Use hand gestures when you need to emphasize a point.
Vary your tone and volume for emphasis.
Stand straight but comfortably.
Dress in a neat and presentable manner.
Before delivering your speech to your chosen audience, practice delivering the speech in front of a mirror or a smaller audience such as close friends or family members. Then, you will deliver the speech to your chosen audience. You can also use an audio recording tool, to record your speech and submit an audio version of your speech to your teacher, if your teacher agrees. However, this is not mandatory.

Answers

Answer:

speech making is not necessarily a tedious process.

Explanation:

Practising helps to strengthen your vocabulary, anf to identify mistakes that may have been made.

PLEASE HELP ASAP question 16

Answers

Answer:

I believe its A

Explanation:

Hope this helps! Also sorry if its wrong. It just seemed like the best answer to me

A I think if not b I’m sorry!

I need a speech about something your passionate about.
It could be literally anything.
Or any ideas.

Answers

Answer: some ideas your room, your style/aesthetic, your hair, your relationships, some of your hobbies, your love for your god/gods, a book(s), making stories, a small business of yours, etc. the possibilities are endless

Hope this helps you out :D

Answer: I believe that people who stutter should not be made fun of. Stuttering — also called stammering or childhood-onset fluency disorder — is a speech disorder that involves frequent and significant problems with normal fluency and flow of speech. People who stutter know what they want to say, but have difficulty saying it.

They don't deserve to be laughed at. They deserve to be supported and helped. None of the kids with this disorder asked for it. They definitely didn't asked to be shoved around, picked on, made fun of, laughed at, and there is SO much more that people do just to be mean to them.

The kids who are mean deserve to be shown how it feels. Now I'm not saying that they need to me made fun of or have a disability. I'm saying that they need to sit down with someone, and learn what it means to have this disorder. For those of you who have ever picked on anybody, have you stopped to think about what they might be going through?

You can copy the speech if you want. Hope I helped. Please just say thanks by pressing the heart button.

What prompted Father to give his sons a lesson about the dangers in life?

Answers

The boys see all animals as cuddly, not at all resembling the dangerous beasts that they are. In order to teach his sons about the dangerous natures of predatory animals, the father makes the boys watch a tiger devour a goat. Pi's response is “Life goes on and you don't touch tigers."
hope this helps!
would love brainliest if it did help :)

Read the excerpt from "My First Memory (of
Librarians)."
The implicit details in this excerpt show that the speaker
feels
The welcoming smile of my librarian
The anticipation in my heart
All those books-another world—just waiting
At my fingertips
excited to learn about new places and things.
confident that the librarian likes her more than others.
unhappy that she has to wait to read all the books,
upset that there are too many books to explore

Answer:excited to learn about new places and things

Answers

Answer:a,

Explanation:

Excited to learn about new places and things

Answer:

A

Explanation:

i did it on edge In 2020

(Help needed please) The narrator’s motivation for reading in class is...
A) escaping the wildness of the room
B) her desire to get good grades
C) respect for her teacher
D) escaping chorus because she hates music

Answers

A) escaping the wildness of the room

what are some example of justice in to kill a mockingbird​

Answers

Answer:

To Kill a Mockingbird by Harper Lee is full of instances of both justice and injustice, and most of them happen outside of the courtroom. In fact, the most obvious miscarriage of justice happens in a courtroom but is redressed outside of it. Both Cecil Jacobs and the Finches' cousin Francis are served a little justice by Scout in the form of a physical blow. Both boys accuse Atticus of being a bad lover who defends guilty black men, and both of them get punched for saying it. This is a form of "fair treatment and due reward" for their insults. Neither boy is punished (in fact, Scout is the one who gets punished), but Scout upholds what she sees as justice ("fair treatment") in the most obvious (and admittedly reactionary) way she knows how.

Hope this helps) Sky

What’s direct characterization

Answers

Answer:

Direct characterization is a method of indicating what a character is like by directly stating their personality traits. Characterization is the process of making a character (usually a fictional one but not always) seem like a fully fledged person by providing details about their personality.

Explanation:

Answer:

Where the author gives direct examples of the characters feeling's thought's and you can understand the character.

Explanation:

For example: she is kind, smart, and pretty.

That's an example of direct characterization because you have details about the person or story.

Hope this helped.

Help me plsss-
How does rereading information in a text help a reader monitor comprehension?

A. The reader can look up the definitions of difficult vocabulary words by reading additional references.

B. The reader scans the information in the text quickly to get a general idea of what the text is about.

C. The reader learns about the time period when the text was written by reading the author’s biography.

D. The reader gains a clear understanding of the details in the text before moving on to read more.

Answers

Answer:

D

Brainliest?

     

 

Answer:

D

Explanation:

The reader needs to gain a great and clear understanding before they continue which helps comprehension

help please ?Explain the difference between positive and negative body language and give some examples. Also explain how positive body language supports communication and how negative body language can cause problems in communication. *

Answers

Answer:

Positive body language can include smiling, waving, and maintaining eye contact, while negative language can include frowning, crossing your arms, moving around and fidgeting, and looking away from the speaker. The difference is that positive body language can improve the mood of a conversation because both people will feel like the other is appreciating what they're saying, whereas negative body language can promote the idea that one person (or maybe both) don't want to listen to the other.

Explanation:

Hope this helps and good luck! :D

Answer:

Well I think that positive body language would be how you express yourself in a good way as for negative would be expressing yourself in a bad way.

Explanation:

Examples - negative would be throwing things because your mad and positive would be dancing ao showing your happy.

What are the purposes of the imagery in this excerpt?
SELECT 3 OPTIONS
to emphasize how dangerously packed the streets are
to indicate that the soothsayer will talk to Caesar
to show that the soothsayer will send the people home
to highlight the idea that Caesar suffers from illness
to suggest that Caesar will soon be put to death​

Answers

To show that the soothsayer will send the people home

Answer:

A, B, E

Explanation:

I got 100% on edge

I NEED HELP ASAP PLEASE

1.highlight the independent clause in blue and the dependent clause in yellow.
2. place a comma between the clause if the dependent clause if first.
example blue: Mr. Wallace loves complex sentences yellow: because they are cool

Answers

1. Independent is "the dog will bite him", Dependent clause" If Charlie-that dog"(comma)

2. Independent clause "We took pictures" dependent "while monkeys-from the trees"

3. Independent"my dad-garden" dependent" whenever-trouble"(comma)

4. Ind." you need-class" dependent-"when-starts"(comma)

5. Inde. " make-lost" dependent-" Before-pencil"(comma)

6.Ind. "I-dentist" Dependent"because-hurt"

7.Ind"I-mistakes" dependent"After-project"(comma)

8. Ind." it-homerun" Dependent "If-feet"(comma)

9. Ind."we-movies" Dependent"until-nap"

10.Ind. "alice-piano" Dependent"while- flute"

Hope that helps

Read the central idea from "A Home Away from Home."

Grandma Rose was an important person in the narrator's life.

How does the author develop this central idea over the course of the memoir? Select the two correct answers.

A. by observing that Grandma Rose was the center of her family's universe
B. by explaining that she was named Caroline Rose after her Grandma Rose
C. by explaining that both she and Grandma Rose were considered stubborn
D. by describing herself as a lost book that had finally been returned to its shelf

Answers

Answer:

b and c

Explanation:

i took the test on k12

Answer:

The answers are

B.  by explaining that she was named Caroline Rose after her Grandma Rose

C. by explaining that both she and Grandma Rose were considered stubborn

I took the test and these were the correct answers

Hope this helps <3

Select Yes if the group of words in italics is a noun phrase
select no if the group of words in italics is not a noun phrase​

Answers

Answer:

Order by columns: yes, yes, yes no. Hope this helps :)

Explanation:

Read "Elsa's Afternoon."
Identify at least four incorrect verb tense usages.

Write the paragraph as it is below (with errors).

Bold, circle, or underline each incorrect verb tense you have identified.

Elsa's Afternoon:

Elsa will complete her homework quickly, so she finished with plenty of time. She want to get done early so that she would have time to practice her routine. Elsa have cheerleading practice later that day, so she wanted to make sure she knew her cheer. She had been practice for nearly an hour outside when her mother yells that it was time to come in.

Answers

Answer:

the wrong phrases are she want, Elsa have, she had been practice, and when her mother yells

HELP PLS!!! ⚠️ Which statement best explains how the modern story transforms the ideas of the original myth?

Answers

Answer:

I think the answer is D

Explanation:Tell me if it helps:)

Answer:

d

Explanation:

because it is the only one that makes sense after reading the passage!!!!!

COPY THE FOLLOWING PARAGRAPH AND EDIT IT(CORRECT). ONLY RUN-ONS AND FRAGMENTS;

I had a frightening dream last night,I dreamed that I was walking high up on an old railroad trestle. It looked like the one I used to walk on recklessly. When I was 10 years old. At that height my palms were sweating, just as they did when I was a boy. I could see the ground out of the corner of my eye, I felt a sickening sensation. I realized there were rats below. Thousands and thousands of rats. They knew I was up on the trestle, they were laughing. Because they were sure they would get me. Their teeth glinted in the moonlite, their red eyes were like reflectors. That almost blinded my sight Sensing there was something even more hideous behind me. I kept moving forward. Then I realize I was coming to a gap in the trestle. There was no way I could go back I would have to step over the empty gap. I leap out in despair. Knowing I would never make it. And felt myself falling helplessly down to the swarm of rejoicing rats. I woke up bathed in sweat.Half expecting to fins a rat in my hand.

Answers

Answer:

I had a frightening dream last night. I dreamed that I was walking high up on an old railroad trestle, it looked like the one I used to walk on, recklessly, when I was 10 years old. At that height, my palms were sweating, just as they did when I was a boy. I could see the ground out of the corner of my eye. I felt a sickening sensation. I realised there were rats below; thousands and thousands of rats. They knew I was up on the trestle. They were laughing because they were sure they would get me. Their teeth glinted in the moonlight, and their red eyes were like reflectors that almost blinded my sight. Sensing there was something more hideous behind me, I kept moving forward. Then, I realized I was coming to a gap in the trestle; there was no way I was going back, I would have to step over the empty gap. I leapt out in despair, knowing I would never make it, and felt myself falling helplessly down to the swarm of rejoicing rats. I woke up bathed in a sweat, half expecting to find a rat in my hand.

Explanation:

I have only corrected the incorrect punctuation, but there may be some spelling errors and wrongly placed tense and vocabulary in the paragraph, still needing editing. I hope this was a help for you as I have always enjoyed the subject English in school.

which transition is the best choice to start the bolded sentence Some people are born superstars really Michael Phelps the Olympic swimmer is a perfect example blank his hands and feet are bigger than normal which means which helps him move quickly through the water he can reach his arms high above and said than other swimmers A however be Bmorever V finally D equally important​

Answers

Answer:

i think that is correct

Explanation:

i know this does not help but i tried

Which graphic feature best enhances the passage?

Answers

Answer:

The graphic is a step by step graphic. Because of the words then and first. The meaning of this text and graphic is to show the steps of keeping specifically sixth graders healthy. They show this by showing the steps of the action they are going to take to help try to prevent sixth graders getting sick.

Explanation:

Answer:

top left

Explanation:


Which sentence describes the climax of the tale?
The husband encourages his wife to look at her reflection.
The husband returns from his journey with presents for his wife.
The mother tells her daughter to look in the mirror every morning
and evening
The mother decides to stop looking in the mirror and to appear
happy at all times.


Plz answer quick

Answers

The mother decides to stop looking in the mirror and appear happy at all times

What information supports the idea that food should not be left out overnight?

A) Canned foods must be cooked to a high temperature under pressure as part of the canning process.
B) Recently, a number of outbreaks have been traced to fresh fruits and vegetables that were processed under less than sanitary conditions.
C) A broiler chicken carcass can be exposed to the drippings and juices of many thousands of other birds that went through the same cold water tank after slaughter.
D) Given warm moist conditions and an ample supply of nutrients, one bacterium that reproduces by dividing itself every half hour can produce 17 million progeny in 12 hours.
E) Changing a baby's diaper while preparing food is a bad idea that can easily spread illness.

Answers

Answer:

Either C or D. I would go with C.

Explanation:

Answer:

D)

Explanation:

You don't want food to be left out over night because of the risk of the food becoming spiled or for bacteria to get a chance to reproduce rapidly and cause sicknesses.

can I have a brainliest?

Question 9 (5 points)

Read the two fictional conflicts below. Using complete sentences, explain how the differences in setting might affect the protagonist.

Story A: A boy gets caught stealing an apple in a crowded high school lunchroom.

Story B: A boy gets caught stealing an apple in a four-person lifeboat that has been drifting at sea for three days. (5 points)

Your answer:

Answers

Explanation:

From Story A since we are told that the boy gets caught stealing in a crowded high school lunchroom it is very possible for many to become aware of his actions; bringing him more shame and punishment.

However, in Story B, since we are told the boy was caught stealing in a four-person lifeboat that has been drifting at sea for three days, it is reasonable to believe that the protagonist (the boy) would face far lesser punishment because of the circumstances;

Remember, we are told that the lifeboat has been drifting at sea for three days, which means there may have been insufficient food onboard which likely lead to the theft.Because the number of those that are onboard is lesser, he will face lesser punishment.

Answer: story A: since the room is more congested, more irregular individuals detect that the individual has been seen robbing; thus, their intention is slightly acting. The protagonist's intention is not to look as sinister. Whereas in story B, the ship's individuals are numerous, exhausted, and likely to have eaten a lot. Therefore, they are powerless to get mad or, should I express it, hungry, so the protagonist could be abused or examined highly poorly in that setting.

What is relevant evidence? evidence that is based mostly on opinions, with few facts evidence that is based mostly on facts with few opinions evidence that directly supports a key idea or point © evidence that detracts from key ideas or points​

Answers

Answer:

evidence that directly supports a key idea or point

Explanation:

The relevant evidence include option C: evidence that directly supports a key idea or point.

What do you mean by Relevant Evidence?

The relevant evidence is defined as the evidence that have more power in order to make given facts and figures more reliable or actions more probable or less probable.

Moreover, it can be a oral or written based upon the prescribed situation and relating to any complaint or any circumstances who are in the investigation process.

Every decision should me make on the basis of relevant evidence in order to generate more reliable results.

Adding to it, it does not depends upon few or some opinions and detracts from key ideas or points because it generally rely upon the direct ideas. Hence, the options A, B and D are incorrect.

Therefore, correct option is C.

Learn more about Evidence, refer to the link:

https://brainly.com/question/6764645

#SPJ2

Other Questions
The Ottoman and Safavid Empires were also known as what empire The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first a homogeneous is a mixture The surfaces of the leaves of many plants help to reduce water loss because they are not water-permeable. How does the biomolecule that makes up this surface differ from other biomolecules? It is made up of long chains of fatty acids.It is made up of polymers of monosaccharides.It is made up of long chains of nucleotides.It is made up of polymers of amino acids. Help please!! Ill give brainlies please help me please ok so is it fake to be honest???Like i told this boy the truth bc no one ever does nd they called me fake??so it tht fake or no??nd why?? Explain, In a summary paragraph, why France gave up much of its North American Colonies following the Treaty of Paris? Please find the value of x with explaination HELP ME PLZZ I NEED HELP WITH THIS!!! In three to five sentences, state one of the benefits of studying music theory and why it's important. PLEASE HELPPP1) Briefly describe the process of DNA replication. a) Start with the molecular machinery and be sure to describe what DNA polymerase does. Use the terms free nucleotides, helicase, polymerase, complementary.b) describe the result; how many strands were made? Describe their composition. Use the terms parental DNA and new DNA. What was the impact of the petition of right? The model represents an equation. What value of x makes the equation true? I have no idea what these notes are can someone please help! These are violin notes. If you want to ensure that a particular application receives priority access to the network, you should configure what feature on the router? QoSDHCPUDPARP what does a literary critic help readers understand what is bigger 2/5 or 0.25 sam eats 1/4 of a pizza joe eats 1/2 of the remaining pizza. what part of the original pizza is left? 3. After 6 weeks, who earned more money? How much more money?