The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces)

Answers

Answer 1

Answer:

LVAAMQLLLLLFLLLFFLV

Explanation:

Transmembrane domains are hydrophobic regions inserted into the cell membrane, while surrounding protein regions are often designed to localize on opposite sides of the membrane. In general, hydrophobic amino acids are inserted into the hydrophobic core of the membrane. These hydrophobic residues have side-chains which are insoluble in water. Examples of hydrophobic amino acids, such as those observed in the putative hydrophobic transmembrane region, include leucine (L), valine (V), alanine (A), methionine (M) and phenylalanine (F).


Related Questions

Termites are unable to digest some plant materials (fiber). Termite stomachs contain bacteria that digest the fiber in wood for the termites. In turn, the bacteria are provided with a hospitable environment to carry out their life processes.

Answers

Answer: The question is not complete, the completed part is which type of relationship is it.

MUTUALISM

Explanation:

MUTUALISM is a symbiotic relationship that exist between organisms in which both the organism benefit from the relationship and there is not loss.

It is MUTUALISM because, the termite benefited from the relationship because the bacteria help it to digest and break cellulose for easy absorption and the bacteria benefited by obtaining accomodation and feeding on the left over of termites.

The two organisms actually benefited from each other.

Answer:

The question is not complete, the completed part is which type of relationship is it.

MUTUALISM

Explanation:

Which of the following can be factors in both sympatric and allopatric speciation?
a. habitat differentiation.
b. geographic separation stion.
c. gene flow.
d. sexual selection.
e. polyploidy.

Answers

Answer: Option B.

Geographic separation.

Explanation:

It is geographic separation that is common to both of them because

Sympatric speciation to occur when certain populations of species isolate reproductively from the the main populations because they can not longer interbreed with each other and they inhabit the same geographical location.

Allopatric speciation occur when two populations of the same species separate from each other geographically which can be as a result of one group of population move to another geographical location.

Several scientists from different countries are asked to examine the results of an experiment before a journal will print it.

Which term best describes this step of the investigative process?
question
communication of results
peer review
experiment control

Answers

Answer:

peer review

Explanation:

In science, results or findings from an experiment are usually published in journals. However, before they can be published, they have to undergo series of confirmation. One way to do this is to have several other scientists examine the results before finally publishing it. This is called PEER REVIEW.

PEER REVIEW is the process whereby an article that is about to be published in a scholarly journal is reviewed by researchers or scientists from the same field of study as the original scientist in order to ascertain the quality and validity of the result or findings. A peer-reviewed article is deemed to be of a very high quality.

Answer:

C. Peer review

Explanation:

I did the test

3. Why are electrical wires in electric
circuits covered in plastic?
(1)

Answers

Answer:

Explanation:

it is rubber not plactic in a wat the eletrisaty boinces off it. it keeps eletrisaly in and not out

In order to prepare an optimal heat-fixed bacterial smear for staining, one must be aware of a couple of factors that may lead to poor results; briefly explain these. Why is it necessary to heat fix a smear for simple staining?

Answers

Answer:

The answer is below

Explanation:

Some of the factors that may lead to poor results in an optimal heat-fixed bacterial smear for staining are the following:

1.  Thickness of the smear: In a situation whereby the smear is too thick, it would be impossible to perform adequate decolorization.

2. Quantity of Decolorizer: if the quantity of the decolorizer or reagent is concentrated, the quality of the stain will be affected

3.  Age of the culture: Older cultures have multiple ruptured and dead cells, which result in staining Gram-negative.

4. Duration of Decolorization:  Overheated smear during heat fixing, often leads to the rupture of cell walls.

The reason it is necessary to heat fix a smear for simple staining is that:

Heat fixing affects bacterial enzymes original state, which hinders their cell digestion parts, thereby leading to the breaking of the cell. The heat also improves the steadfastness of bacterial cells to the slide.

It is essential to heat and fix a smear for simple staining as it helps the bacteria to get attached with the slide. However, one must also be aware of the factors, which may lead to poor results.

What is heat fixation?

It is a laboratory method used commonly in histology, cell biology, and pathology in which a slide with a specimen like bacteria is passed via the source of heat for many times.

It is an essential step in the procedure of staining as the heat fixation denatures the bacterial enzymes that can autolyze the cells of bacteria, therefore, to inhibit this there is a need to heat fix the smear. The heat fixation also enhance the attachment between the bacteria and the glass of slide so by which one can witness the smear clearly under the microscope.

Apart from these, there are some factors, which can result in poor results. Like when mixing bacteria with water, if one overmix, it can lead to inaccurate cell patterns. At the time of heat fixing, if one hold the slide over the flame for long duration, one would incinerate the cells.

Thus, heat fixing is important for the proper attachment of the bacterial cells with the slide and for proper visibility of the smear. One should also be careful about the factors, which may lead to  poor results.

Find out more information about heat fixation here:

https://brainly.com/question/5714447

What are the four major categories of micromolecules? Describe the basic structures and the primary functions of each.

Answers

Answer:

There are four major classes of biological macromolecules (carbohydrates, lipids, proteins, and nucleic acids); each is an important cell component and performs a wide array of functions.

Explanation:

The amount of energy added for a chemical reaction to start is?

Answers

Answer:

Activation Energy

Explanation:

Answer:

Activation Energy

Activation Energy is the minimum amount of energy needed to start a chemical reaction.

Explanation: hope this works

Which of the following are NOT examples of matter (CHOOSE ALL THAT APPLY)?
a table
light
air
a flower
heat
a virus

Answers

Answer:

Hey There!

Your answers are:

LIGHTHEAT

Explanation:

Matter is ANYTHING that takes up space, has a mass and has a volume...regardless if it is minimal...

Heat and Light DOES NOT have any volume, mass or take up space therefore  they aren't examples of matter!

I HOPE THIS HELPS WITH YOUR WORK!

:D

10. How do photosynthesis and cellular respiration differ?

O a. Photosynthesis uses food and cellular respiration produces food
О
b. Photosynthesis gives off oxygen and cellular respiration uses oxygen
c. Photosynthesis uses oxygen and cellular respiration uses carbon dioxide
d. Photosynthesis breaks down carbohydrates and cellular respiration produces them

Answers

Answer:

B

Explanation:

Photosynthesis involves the use of energy from sunlight, water and carbon dioxide to produce glucose and oxygen. Cellular respiration uses glucose and oxygen to produce carbon dioxide and water.

kim has a bag of yo-yos. Some of the yo-yos are red. The rest are yellow. The ratio of the number of red yo-yos to the number of yellow yo-yos is 5 : 9. If kim has a total of b yo-yos, how many more yellow yo-yos than red yo-yos are there?​

Answers

Answer:

5 + 9 = total = 14

14 = total = b

5/14 of them are red 9/14 are yellow

yellow - red = 9 / 14b - 5 / 14b = 4 / 14b = 2 / 7b there are ( 2/7 ) b more yellow than red CAUSED apologiabiology .

Hope this helps ✌️

Answer:

╔═════════════╗

║██░░░░░░░░░░░╚╗

║██░░Low Battery░░ ║

║██░░░░░░░░░░░╔╝

╚═════════════╝

Why do classification systems change over time?
Scientists find new evidence in their studies,
Scientists use old methods of classification.
Scientists repeat experiments and find no changes.
Scientists find similar evidence to previous work.

Answers

Answer:

Classification system changes because the scientists find new evidence in their studies.

Explanation: The world is always changing and growing and dying as well as developing, so over time things change. For example, as you grow up do you stay the same? No, you notice the physical changes happening, well thats sort of like how the earth and its ways are always changing as well.

Classification systems change over time - Scientists find new evidence in their studies

Millions of plants, animals, and microorganisms are present on the earth. They have been identified by scientists, however, There are many new species are still being discovered around the world.

Scientists find new evidence and species that may have to change classification systems in order to manage new systematics and taxa or ranks.to classify these newly discovered species, with new characters, new systems of classification have to be devised every now and then.

Thus, Classification systems change over time - Scientists find new evidence in their studies

Learn more:

https://brainly.com/question/1855947

The body stores excess fat in nephrocytes.
a. True
b. False

Answers

Answer:

Verdadero

Explanation:

ALMACENA GRASA BLANCA

The statement "The body stores excess fat in nephrocytes." is false because excess fat is stored in the adipose tissue.

What is fat?

Fat is a waxy substance that is made up of esters of fatty acids. It is necessary for body structural growth, but excess fat causes weight gain and many diseases.

Adipose tissues are found under the skin cell and under the cell of internal organs. They develop due to the accumulation of fats, they are also called fat cells. It is also called energy reservoirs.

Nephrocytes are present in the kidney, and they function as storage of excretory material. They do not store excess fats. Excess fat is stored by the adipose tissue in the form of triglycerides. The fat produces energy at the time of need.

Thus, the statement is false.

To learn more about fat, refer to the link:

https://brainly.com/question/4785527

#SPJ2

HCl is added to a solution containing barium and calcium ions. If a precipitate is formed, what is it? A. No precipitate is formed B. Barium chloride

Answers

Answer:

A. No precipitate is formed.

Explanation:

Hello,

In this case, considering that both calcium chloride and barium chloride are CaCl₂ and BaCl₂ respectively, due to their high polarity by cause of the ionic bond they have between calcium and chlorine and barium and chlorine we say they are highly soluble in water, therefore, A. No precipitate is formed.

Best regards.

The hormone oxytocin aids the birth process by stimulating:__________

Answers

Answer:

The hormone oxytocin aids the birth process by stimulating: uterine wall contractions.

Explanation:

Oxytocin is a hormone that is released naturally in the body of women and that intervenes in certain physiological processes, activating behaviors at a mechanical level in specific organs such as the uterus and the breasts.  In the case of the uterus, oxytocin stimulates and maintains the contraction of the smooth muscle of the uterus during labor and delivery, that is, it is responsible for the existence of contractions, which occur during intercourse, due to the distension of the uterus that occurs produced during labor.

4. Why are the results of the survey most likely unreliable?

Answers

Answer:

See the answer below

Explanation:

The results of surveys are most likely unreliable because surveys generally deal with questions that require value judgements or reporting beliefs. Consequently, there is no way to ascertain the objectiveness of responders and in most cases, responses are often biased.

Most survey questions are themselves inherently biased and only honest responses can make their results to be reliable. Unfortunately, there is no way to determine the veracity of responses. However, the unreliability of surveys reduces as the number of responders to the survey increases.

Two closely-related insect species are being discovered. Scientist are focusing on how long it takes each to develop limb buds following fertilization. What evidence of evil outlook is this an example of

Answers

o Explanation:

o gecromo e  oo rat

If water molecules surround a solute particle with their oxygen ends all pointing to the solute particle, what can you conclude about the charge of the solute particle? Is it positive, negative, or neutral, and how do you know?

Answers

Answer:

It is +

Explanation:

Water molecules are polar, with partial positive charges on the hydrogens, a partial negative charge on the oxygen. So your solute would attract the opposite charge which is the Oxygen

Polar water molecules have partial positive hydrogen charges and partial negative oxygen charges. Thus, oxygen would attract your solute having positive charge.

What is polarity?

Polarity is the separation of electric charge that occurs when a molecule or its chemical groups have an electric dipole moment. This results in the molecule or chemical group having one end that is positively charged and one end that is negatively charged. Because of the disparity in electronegativity between the atoms that are linked together, polar molecules are required to have one or more polar bonds.

Polar water molecules have partial charges in both the hydrogen (positive) and oxygen (negative) directions, though mostly in the hydrogen's favor.

Therefore, oxygen would be attracted to your solute if it had a positive charge.

Learn more about polarity, here:

https://brainly.com/question/3184550

#SPJ2

how is a scientific law different from a scientific theory?

Answers

Answer:

A theory is something that isn’t proven false or true. Weather to a law it is proven and can state the facts.

Explanation:

6. DNA contains the nitrogen bases of adenine, guanine, cytosine, and
O Peptide
O Glycerin
O Uracil
O Thymine

Answers

Answer:

The fourth nitrogen base is THYMINE.

Which of the following plant systems is involved in the process of drawing up nitrogen from the surrounding soll?
stems
leaves
O flowers
O roots

Answers

Stems would draw up nitrogen

What's the difference between a producer and a consumer? Where do producers belong in a food chain?

Answers

producers are at the bottom or beginning of the food chain because they produce their own food. producers do not eat other organisms unless there are exceptions. consumers eat other consumers and also eat producers.

Stroke volume is the amount of blood that leaves the left ventricle of the heart with each contraction. If a person has a stroke volume of 80 ml/beat, how many liters would that be?​

Answers

Explanation:

The amount of blood that leaves the left ventricle of the heart with each contraction is called Stroke volume.

A person has a stroke volume of 80 ml/beat. It means that it is 80 milliliters per beat.

We need to find how many liters would that be.

We know that, 1 litre = 1000 milliliters

1 mL = 0.001 L

To convert 80 mL to litres, we can do it as follows :

80 mL = (80 × 0.001) LL

= 0.08 L

Hence, he stroke volume of a person is 0.08 L/beat.

Which scientist is known for famously naming the cell after tiny rooms in a monastery? 1. Bill Nye 2. Robert Hooke 3. Aristotle 4. Theodor Schwann

Answers

Answer:

robert hook

Explanation:

 

со
SKILL:
mole
Re-
CH,OH
C с
Н
Н
ОН
Н
НО
С.
ОН
С
Н
ОН
СН,ОН

Answers

Lol what is this supposed to mean

Explain why a plant cell needs a cell wall but an animal cell does not. Feel free to add an image to support your explanation.

Answers

Plant cell needs cell wall whereas animal cell do not because the plants need rigid structure so that they can grow up and out . All cells have cell membranes, and the membranes are flexible. So animal cells can have various shapes, but plant cells only have the shapes of their cell walls. I don’t know if this is what u were asking but I hope it helps.

If a claim is mainly supported by anecdotal evidence (stories or claims by people), It is
likely

Answers

Answer:

Biased.

Explanation:

Anecdotal evidence is described as the evidence that is based entirely upon an individual's personal experiences or observations.

As per the question, a claim based on such evidence is most likely to be biased as anecdotal evidence is based on a limited selection of examples that either support or refute the claim but not supported by any scientific or statistical analysis. Due to this undue bias, anecdotal evidence is not considered reliable as it displays the personal opinion, feeling, or experience of an individual. Thus, it may be used to negate the general statements but not to support r substantiate a claim or argument.

What are two ways bacteria and protists can be helpful to people?

Answers


Bacteria: They are in your intestines to break down food and produce vitamin k your body needs.

Protist: Plant-like protists produce almost one-half of the oxygen on the planet through photosynthesis.

Hope this helps in some way !

PLEEEEEASSSSSSSEEEEE HELP :,,,,,,,,,|

Answers

Answer:

Explanation:

So what do u need help with

Answer: the answer i believe is C

1. The Devonian period is considered the Age of Fishes. Would you expect
to find a tetrapod (animal with four legs) fossil closer to the
Carboniferous period or the Silurian period? Why?

Answers

Answer:

You would find one closer to the Carboniferous period.

Explanation:

You would find them closer to there because all life started out in the ocean and it took several eras for the land creatures to develop legs and the first era to have them is the Permian era and towards the end of the Carboniferous period. While the Silurina era was much earlier then both and still heavily influenced by crustaceons and other such sea creatures.

Since the first tetrapods appeared at the end of the Devonian period, it is expected to find tetrapods fossils closer to the Carboniferous than to the Silurian period.  

--------------------

The paleozoic era goes  from 570 to 250 ma ago.

The era is composed of the following periods

CAMBRIC (570-490 ma)ORDOVICIC (490-443 ma)SILURIAN (440-400 ma)DEVONIAN (400-360 ma)CARBONIFEROUS (360-290 ma)PERMIC (290-250 ma)

SILURIC (440-400 ma)

Gondwana was already formed. Laurasia was in its formation process

This is a recovery stage after the big massive Ordovician extinction.

Trilobites diversification and occurs bivalves' radiation.

The first gnathostomes appear.

First records of terrestrial vascular plants ⇒ small and with no supporting structures, inhabiting the water margins.

DEVONIAN (400-360 ma)

There are new adaptative strategies that separate even more the marine environment from the terrestrial one.

Age of Fishes

Definitive colonization and diversification of species in the terrestrial environment.

During this period, among other events, emerged the lineage that would later originate tetrapods, by the end of the period.

The first Ichthyostega emerges, which could be the ancestor of amphibians.

Expansion and diversification of plants

Firsts terrestrial arthropods emerged. Coevolution with plants started.

A big massive extinction occurred at the end of the period that severely affected the marine environment. Occurs a gradual replacement of terrestrial plants.

CARBONIFER (360-290 ma)

Begins Pangea formation

There is an ecological rechange in the ocean after the extinction

Amphibians emerge on the ground.

The first reptiles appear as anapsids, synapsids, diapsids.

Complete independence from water.

There was a diversification of horsetails and tree ferns, pro-gymnosperms, and gymnosperms.

Insects proliferation.

According to this information, by the end of Devonian period the firsts tetrapods appeared.

During the Carbonifeous period, after the devonian massive extinction amphibians and reptiles appeared.

These sequences indicate that tetrapod fossils are closer to the  Carboniferous period than the Silurian period.

----------------------------

Learn more about Devonian period at

https://brainly.com/question/8930188?referrer=searchResults

https://brainly.com/question/19837678?referrer=searchResults

In a cup of tea, what is solvent? What is solute?

Answers

(Sweetened iced tea) is a solution in which solid sugar (the solute) is dissolved in cold liquid tea, which is mostly water (the solvent).

Sugar is the solute and tea is the solvent and mixture of tea and sugar is solution.

What is solution, solute and solvent?

An answer is a homogeneous combination of at least one solutes broke up in a dissolvable.

dissolvable: the substance wherein a solute breaks up to create a homogeneous blend

solute: the substance that breaks down in a dissolvable to create a homogeneous combination

Note that the dissolvable is the substance that is available in the best sum.

A wide range of sorts of arrangements exist. For instance, a solute can be a gas, a fluid or a strong. Solvents can likewise be gases, fluids or solids.

Learn more about solvent here:

https://brainly.com/question/1416865

#SPJ2

Other Questions
-4|2w + 61 = -32. Whats the answer which of the following is not a ratea. 3miles / 5 hoursb. $15/ 3 hoursc. 5 inches / 20 inches d. 12 pencils / 1 box why do neutral atoms lose or gain electron? Can someone please help me out and explain what this means?? "Comment closely on the following passage, considering its presentation of the narrators experience" What effect did the introduction of smallpox have in Americas how the telecommuting impact the economy? How do you graph y=-3x+2 y=2x-3 Cookies cost $3 each, and candies cost $2 each. Tim has$25. Which inequality represents the number of cookies, x,and the number of candies, y, that Tim can buy? A car on a racetrack drove 96 miles in 60 minutes how long did it take to drive 10 miles Bridal Solutions, which sells European wedding dresses, has the following weeklyrevenue and cost functions:R(d) = 12000C (d) = 350d + 5000where R (d) represent the weekly revenue for selling d wedding dresses andC(d) represent the weekly cost for selling d wedding dresses. What are graphs used for? Select all that apply.analyzing what data meansforming experimentsdiagram showing the correlation between two quantitiespredicting outcomes and patternsthanks :)) Solve for x: 3(x + 1) = 2(x - 1)0-5O-4O-20-1 Captain John Smith's declaration "He that will not work shall not eat" drove the Jamestown settlers to start: A trading B hunting C building D Farming A single atom of an element has 11 protons, 11 electrons, and 12 neutrons. Which element is it?yO NaOMgO Se Are cave snotties alive? Explain how. Which input value produces the same output value for the two functions on the graph? The basic principle in balancing a chemical equation is to ______. View Available Hint(s) The basic principle in balancing a chemical equation is to ______. have the sum of coefficients in reactants equal to that in the products have the same number of atoms of each element in the reactants and in the products have the same number of reactants as products have the same number of molecules of each substance in the reactants and in the products is Y=3x proportional or non proportional? Which of the following is an example of time-sharing?A file used to update several student tuition paymentsAn immediate change in a student's scheduleA file used to update several student tuition paymentsSeveral personnel accessing the registration system Jeene and her friends were selling cookies. They sold four more boxes second week in the than they did the first week . On the third week they doubbled the sale of their second week. Although they sold a total of 352 boxes how many boxes that they sell in the third week?