the nurse observes a wrench taped to the head of the bed of a client who is currently in surgery. which device does the nurse expect this client to have when returning to the care area?

Answers

Answer 1

The device Apathy or an unwillingness to wake up, a headache that worsens and does not go away.

Which finding is indicative of a basal skull fracture?Several clinical indicators that are strongly suggestive of a basilar skull fracture include: Hemotympanum, Blood will collect behind the tympanic membrane in the event of fractures involving the petrous ridge of the temporal bone, turning it purple.Apathy or an unwillingness to wake up, a headache that worsens and does not go away.Apathy or an unwillingness to wake up, a headache that worsens and does not go away. Speech slurs, numbness, or lack of coordination. nausea or vomiting that occurs frequently, convulsions, or seizures (shaking or twitching).Apathy or an unwillingness to wake up, a headache that worsens and does not go away. Speech slurs, numbness, or lack of coordination. nausea or vomiting that occurs frequently, convulsions, or seizures (shaking or twitching).

To learn more about Skull fracture refer to:

https://brainly.com/question/27961333

#SPJ4


Related Questions

a patient who has acute pancreatitis is prescribed famotidine. the nurse explains that this drug is given for which purpose?

Answers

The function of giving a patient with acute pancreatitis is to reduce stomach acid production.

What is corelation between pancreatitis with stomach acid?

Pancreatitis is an inflammation of the organ lying located behind the lower part of the stomach which is called pancreas.

Pancreatitis could come suddenly and last for days or it may occur over many years. Previous studies prove that anti-acid therapy with proton pump inhibitors can reduce pancreatic secretion and it can be used on treating acute pancreatitis. The common cause of pancreatitis to occur are gallstones that block enzyme regulation in the pancreas.

Learn more about pancreatitis here

https://brainly.com/question/29097123

#SPJ4

the nurse is reading the primary health care provider's (phcp) documentation regarding a pregnant client and notes that the phcp has documented that the client has an android pelvic shape. the nurse understands that which characteristics are included with this pelvic shape? select all that apply

Answers

Android shaped pelvis has triangular or heart-shaped inlet and is narrower from the front.

What is the shape of Android pelvis?

It is rather small in front and has a heart-shaped brim. This form of pelvis is common in African women as well as tall ladies with narrow hips. The pelvic exit and cavity are frequently long, thin, and straight. Ischial spines are clearly visible.

It has a nearly round brim and, under normal conditions, will allow the passage of an average-sized infant with the least amount of stress to the mother and baby.

The pelvic cavity (the interior of the pelvis) is typically small, has straight side walls, and doesn't have particularly noticeable ischial spines that could provide an issue for the baby when it passes through. Babies born to women with this pelvic structure may rest their backs against their moms.

To learn more about Android pelvis refer to:

https://brainly.com/question/16149571

#SPJ4

a client presents in the emergency department with acute onset of fever, headache, stiff neck, nausea/vomiting, and mental status changes. what interventions should the nurse initiate

Answers

The interventions should the nurse initiate are  

1. Elevate HOB 30 degrees

2. Pad side rails

3. Provide sponge bath if temperature greater than 101°F (38.3°C)

4. Darken room

What is bacterial meningitis?Bacterial meningitis is brought on by bacteria that enter the bloodstream, travel to the brain, and affect the spinal cord. A direct bacterial invasion of the meninges, however, can also result in bacterial meningitis. An ear infection, sinus infection, a skull fracture, or — very infrequently — certain operations could be the culprits. 1., 2., 3. & 5. Correct: Meningitis caused by bacteria is associated with sudden onset of fever, headache, stiff neck, n/v, and changes in mental state. To improve comfort and lower intracranial pressure, elevate the head of the bed. The nurse should take seizure precautions, which include padding the side rails, because the client is at a higher risk for seizures. If your fever is higher than 101°F (38.3°C), you should take a sponge bath as an independent nursing intervention.

To learn more about bacterial meningitis refer to:

https://brainly.com/question/11061951

#SPJ4

which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge?

Answers

Examine her nursing methods to find any potential issues. To continue at home, the youngster is given samples of no-salt-added diets.

What is a glomerulonephritis?The small filters in your kidneys are harmed by glomerulonephritis (the glomeruli). Immune system attacks on healthy body tissue are a common cause of it. The typical symptoms of glomerulonephritis are nonexistent. Blood or urine tests that are performed for another purpose increase the likelihood of a diagnosis.After recovering from a strep throat infection or, less frequently, a skin infection brought on by the streptococcal bacterium, glomerulonephritis may appear a week or two later (impetigo). The glomeruli become inflamed as a result of an accumulation of antibodies to the microorganisms. Symptoms of kidney failure, such as edema (typically in the legs), high blood pressure, and decreased urine production, can appear in very severe instances of glomerulonephritis.

To learn more about glomerulonephritis refer to:

https://brainly.com/question/14010232

#SPJ4

Other Questions
which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge? ache mothers, in paraquay, carry their young children almost all the time to protect them from getting hurt in the forest. consequently, their children walk almost a year later than american children. based on this example, do you think it is the impact of nature, nurture, both or neither that influenced this cultural difference? You develop and deploy several microservices to an Azure Kubernetes Service (AKS) cluster. The microservices are instrumented with the Application Insights SDK. You configure an Application Insights instance and use the connection string in the instrumentation.The instrumentation includes a custom telemetry value used to track the order checkout action. Order checkout is an action that includes a property to capture the order number.You need to capture the custom order telemetry.Which Application Insights data type should you use?Select only one answer.tracedependencymetricevent Otis wants to borrow 10000 to buy a used car. he examined his budget and decided that he can afford a payment of $200 a month. if his bank offers him a rate of 7.5%, how long should he borrow the money so he can afford his monthly payment? two harmonic waves are described by y1= (4m) sin (8/mx-300/s t) y2=(4m) sin (8/mx-300/s t-2) what is the wavelength of the resultant wave ? Below you will find the yearly average values of the Dow Jones Industrial Average, the most popular index of stock market prices, for five different years. The Consumer Price Index for each year (on a base of 1982- 1984 = 100) can be found on the inside back cover of this book. Use these numbers to deflate all five stock market values. Do real stock prices always rise every decade?Year Dow Jomes Industrial Average1970 7531980 8911990 2,8792000 10,7352010 10,663 DXL Practice with algebrai XDL | Identify equivalent in X Q Algebra It A Common Cor X DAt the start of the softball x GIdentify equivalent linear Xbd.com/math/grade-7/identify-equivalent-linear-expressions-word-problems?signinRedirect=https%3A%2F%2Fwww.ixl.com%2Fsignin%2 R.23 Identify equivalent linear expressions: word problems KWH>120xx + 1.2xSubmitAlec's parents give him x dollars per month for his allowance. However, since his birthday isin February, he gets an extra 20% bonus that month.Pick all the expressions that represent how much Alec's allowance is in February.x + 0.2x+1.2x*DX Consider the deflection (based on choices of E and I) and the weight of the material. How would you find a balance between the needed structural performance and weight? what decreases the possibility that errors will be caught and the potential for fraud will be increased? The measure of angle JKL is 145.The measure of angle MKL is 60.The measure of angle JKM is x.Find the value of x.X=0X5XK145M60D the dominican republic has 10.7 million people and a national population growth rate of 1.5 percent. paraguay has 6.8 million people and a national population growth rate of 1.5 percent. in how many years will each country double in size? sean is one of several general partners who own pints and cans, a small chain of bar and grills located in illinois and indiana. sean is interested in converting the partnership into a master limited partnership. if he convinces other partners to go along with his idea, pints and cans will select one: a. offer shares of ownership that are traded on a stock exchange much like a corporation. b. pay its taxes like a corporation. c. begin to operate much like a sole proprietorship. d. have to change its name to include the term ltd. in its title to indicate its owners have limited liability. this tissue type can perform absorption or secretion in the body. Culture is taught formally and informally. Identify the following sources as providing either formal or informal instruction. Did the Filipinos benefit from the political changes that the Spaniards introduced? URGENT- ENGLISH 12 FINAL CONNEXUS PLEASE HELP Jordan has 8 coins in his pocket. They are a combination of dimes and quarters. If they total to $1.25, how many of each coin does he have an equilateral triangle has a side measure of 10 in. what is the measure of each of the angles of the triangle? question 1 options: 10 degrees 60 degrees 30 degrees 18 degrees Russia 1996/4) In the Duma there are 1600 delegates, who have formed 16000 committees of 80 persons each. Prove that one can find two committees having at least four common members. what is the name and formula of the chemical reagent used to separate the cations of group 1 from ions in other groups.