What are the 4 types of conditional sentences examples?

Answers

Answer 1

Conditional sentences are sentences that express a condition or set of conditions and the potential outcome of those conditions being met.

What do you mean by sentences?

Sentences are a group of words that make up a complete thought. They typically include a subject and a verb and express a complete idea. Sentences can be used to convey a variety of messages and emotions, making them a key component of language.

The four types of conditional sentences and their usages are:

1. Zero Conditional         General truths.

2. Type 1 Conditional   A possible condition and its probable result.

3. Type 2 Conditional   A hypothetical condition and its probable result.

4. Type 3 Conditional   An unreal past condition and its probable result  in the past.

Examples:

1. Zero Conditional: If you heat ice, it melts.

2. First Conditional: If it rains tomorrow, I won't go out.

3. Second Conditional: If I won the lottery, I would buy a house.

4. Third Conditional: If I had known about the party, I would have gone.

To know more about sentences,

https://brainly.com/question/552895

#SPJ4


Related Questions

What is a 14 line stanza poem called?

Answers

A 14-line poem with a changeable rhyme scheme called a sonnet was first written in Italy and imported to England in the 16th century by Sir Thomas Wyatt and Henry Howard, Earl of Surrey.

What is a sonnet?

The sonnet is a fourteen-line poetry in iambic pentameter that follows a rigidly structured theme arrangement, uses one of several rhyme schemes, and is composed in a certain rhyme scheme. The word "sonetto" means "a tiny sound or song" in Italian, whence it originated.

What is a stanza?

Similar to a paragraph in prose, a stanza is a unit of poetry. This is a section of a poem made up of several lines strung together. A poem is divided into stanzas as a result. The number of stanzas in a poem might vary from one to several. There should be a space between the last line of one stanza and the start line of the next one when a poem has two or more stanzas. Fixed stanza forms are common in classical compositions with defined forms. In one poem, poets may utilize different stanza forms, or they may stick to a single stanza format throughout the entire poem. One stanza can occasionally function as a different kind of poem all by itself.

To know more about Sonnet visit:        brainly.com/question/1766863    

#SPJ4

Shelby County, Alabama v. Erich. Holder, Jr., Attorney General, Dissenting Opinion
JUSTICE GINSBURG, with JUSTICE BREYER, JUSTICE SOTOMAYOR, and JUSTICE KAGAN

On June 25 2013, the United States Supreme Court ruled that sections of the Voting Rights Act (VRA) of 1965 were unconstitutional. The VRA was enacted to address racial discrimination in voting, but the Court held that the VRA contradicted the spirit of the 10th Amendment. The 10th Amendment reserves all powers—not granted to the Federal Government—for the states. The majority of justices held that VRA required states to ask the Federal Government for permission to enact laws they should have the right to enact.

Several justices, in the minority, wrote a dissent—or disagreeing position—to this opinion. An excerpt of that dissent is offered below.

Dissent
"[V]oting discrimination still exists; no one doubts that." Ante, at 2. But the Court today terminates the remedy that proved to be best suited to block that discrimination. The Voting Rights Act of 1965 (VRA) has worked to combat voting discrimination where other remedies had been tried and failed. Particularly effective is the VRA's requirement of federal preclearance for all changes to voting laws in the regions of the country with the most aggravated records of rank discrimination against minority voting rights.

The Fifteenth Amendment was ratified in 1870, in the wake of the Civil War. It provides that "the right of citizens of the United States to vote shall not be denied or abridged by the United States or by any State on account of race, color, or previous condition of servitude," and it gives Congress the "power to enforce this article by appropriate legislation."

"The first century of congressional enforcement of the Amendment, however, can only be regarded as a failure." (Id., at 197.) In the 1890s, Alabama, Georgia, Louisiana, Mississippi, North Carolina, South Carolina, and Virginia began to enact literacy tests for voter registration and to employ other methods designed to prevent African-Americans from voting. (Katzenbach, 383 U. S., at 310.) Congress passed statutes outlawing some of these practices. And the States came up with new ways to discriminate as soon as existing ones were struck down. Voter registration of African-Americans barely improved. (Id., at 313–314.)

After a century's failure to fulfill the promise of the Fourteenth and Fifteenth Amendments, passage of the VRA finally led to signal improvement on this front.

Although the VRA brought dramatic changes in minority voting rights, the Act surely has not eliminated discrimination against the [voting rights of] minority citizens. [States] continued to submit proposed changes to voting laws that the Attorney General declined to approve, [predicting] that barriers to minority voting would quickly resurface.

Congress approached the 2006 reauthorization of the VRA with great care and seriousness. The same cannot be said of the Court's opinion today. The Court makes no genuine attempt to engage with the massive legislative record that Congress assembled. Instead, it relies on increases in voter registration and turnout as if that were the whole story. Without even identifying a standard of review, the Court dismissively brushes off arguments based on "data from the record," and declines to enter the "debate about what the record shows." One would expect more from an opinion striking at the heart of the Nation's signal piece of civil-rights legislation.

Cornell University Law School: http://www.law.cornell.edu/supremecourt/text/12-96#writing-12-96_DISSENT_5

Read this sentence from the text:

Without even identifying a standard of review, the Court dismissively brushes off arguments based on "data from the record. . ."

What does the word dismissively mean in this text? (5 points)


In a formal and rigid manner

With drama and elaboration

Without giving serious consideration

To the point of danger

Answers

A) In the material provided, the phrase "in a formal and inflexible manner" is used dismissively. with the intention of rejecting or rejecting something. exhibiting or displaying contempt for someone.

How should to speak in formal way?

Improve your tone. Avoid talking too loudly since others will assume you weren't raised properly. Do not, however, speak too casually because it may be assumed that you are timid. Use a medium voice when speaking so that only the person you are speaking to can hear you.

What is formal conversation?

Possessing Proper Conversational Manners Use the words "please" and "thank you" while making requests. When you first encounter someone, introduce yourself by name.

To know more about manner visit :-

https://brainly.com/question/24851955

#SPJ1

How do you write a 5 paragraph essay fast?

Answers

The structure of a five-paragraph essay is comprised of an introduction that introduces the main issue and states a thesis, three body paragraphs that offer evidence for the thesis, and a conclusion.

You'll be able to produce high-caliber papers and essays more quickly if you understand the assignment:

Conduct an effective but relentless investigation.

Create a smooth outline.

Establish the ideal environment for writing.

Follow a Standardized Format.

Prioritize quality over quantity.

Draft and edit independently.

Write the introduction and the summary: If you are having problems writing quickly, your expectations may be too high. You might be setting yourself up for failure if you strive to write flawlessly the first time. Trying to come up with something new each each.

To know more about essays click here:

brainly.com/question/25607827

#SPJ4

how many TV channel were there​

Answers

Answer:

Television in the 1960's was very different from today's T.V. You were only allowed watch the networks on that were put on and that's it. There was only three channels available; ABC, CBS, and NBC.

Channels:

ABC - American Broadcasting CompanyCBS - Columbia Broadcasting SystemNBC -  National Broadcasting Company

Player is to team as inch is to _______ Which of the following best completes the analogy? A. measure. B. short. C. worm. D. foot.

Answers

Player is to team as inch is to option D.) “foot.”

In this analogy, a player is being categorized on a collective level by saying it’s to a team. A single player contributes to an entire team. In this same way, an inch contributes to an entire foot when combined with 11 other inches.

By putting things on a collective level, we can conclude that player is to team as inch is to foot.

for what acts have Martha Corey and rebecca nurse been arrested and charged?

Answers

Rebecca Nurse is charged as a witch for the murder of Goody Putnam's babies. Martha Corey is charged with bewitching and killing a pig. 1.

The Crucible is a drama written by American writer Arthur Miller in 1953. It is a dramatized and somewhat fictionalized account of the 1692-93 Salem witch trials in the Massachusetts Bay Colony. Miller created the play as a parody of McCarthyism, when the US government prosecuted persons suspected of being communists.

Miller was questioned by the House Un-American Activities Committee in 1956 and convicted of contempt of Congress for refusing to name individuals present at meetings he had attended.

Learn more about The Crucible Act 2 to visit this link

https://brainly.com/question/30095719

#SPJ4

Which is the correct form of split '?

Answers

One of the irregular verbs is "split," and among its acceptable spellings are splitting, split, and splits.

One of the irregular verbs is "split," and among its acceptable spellings are splitting, split, and splits. You shouldn't use "splitted"! The past tense form that is "divided" still exists. Only slang, jargon, or even speech from musical passages or fictional characters in stories can we use the word "splitted." The split participle form also continues to be split. Split is the past tense of the verb. Here, the three spit forms are the same, and splitting is the past participle form, thus you may use split in the past tense without changing anything. Split is the past tense of the verb. Here, the three spit forms are identical, and splitting is the past participle form, thus you may use split in the past tense without changing anything.

To learn more about Split Please click on the given link:

https://brainly.com/question/29794444

#SPJ4

What Enlightenment thinker believed that natural rights of individuals should be protected through a social contract?

Answers

Most notably in his book The Social Contract, Jean-Jacques Rousseau (1712–1778) concentrated on the social contract notion (1762).

The concept of the collective will is at the heart of The Social Contract. The general will is used to describe the notion of the common good that all members of a people share. According to Rousseau, a people must nurture concern for the general will rather than individual wills if they want to maintain their freedom and sovereignty over their government (and consequently, private interests).

The collective will, however, is not something that arises "naturally"; rather, it is a result of people making a social compact and deciding to coexist under the same set of laws. As a result, the concept of laws and government is linked to the concept of the general will.

To know more about social contract click here,

https://brainly.com/question/17260213

#SPJ4

Complete the sentences with the correct words formed from the words in bold.
Example: This is a very pressing (PRESS) problem. We must resolve it urgently.



1. What a good idea! I think it’s a(n) _
(WORK) solution.

2. Did you know that snails are _
(VERTEBRATE)? They have

muscle and a shell, but no backbone.

3. The World Wildlife Fund does all it can to protect _
(DANGER) species.

4. This is definitely freak weather. I’ve never seen so much _
(TORRENT) rain.

5. Many people believe that snakes are _
(SLIME), but they aren’t.

Answers

The correct solutions are as follows:

1. What a good idea! I think it’s a(n) work solution.

2. Did you know that snails are vertebrates? They have muscle and a shell, but no backbone.

3. The World Wildlife Fund does all it can to protect dangerous species.

4. This is definitely freak weather. I’ve never seen so much torrent rain.

5. Many people believe that snakes are smiles, but they aren’t.

To learn more about "verbs" here:

brainly.com/question/14584990

1- working
2-invertebrates
3-endangered
4-torrential
5-slimy

What is the role of body language in presentation?

Answers

When you present, having powerful, confident body language is crucial for establishing your authority, expressing your feelings, and engaging your audience.

In presentations and public speaking, what role does body language play?

In public speaking, the use of body language is vital. Having a connection with your audience or colleagues is made possible by having good body language. No matter how engaging your speech's subject matter is, the audience will quickly lose interest if you deliver it without poise or expression.

In the end, the audience values the speaker's active participation more than the actual content. Although it's not that the material is irrelevant, a speaker with effective body language will surpass one with less emphasis placed on it.

Learn more about the presentation with the help of the given link:

brainly.com/question/7132265

#SPJ4

Identify the meter and length of the following line.
"A bird came down the walk"
Meter:
Iambic
dactylic
anapestic
iambic
trochaic

Line length:
Hexameter
Tetrameter
Pentameter
Trimeter

Answers

The identification of the meter and length of the following line is given below:

Meter: iambicLine length: trimeter

What is Iambic Pentameter?

This refers to the term that is used to describe and define the way the traditional English poetry and verse theater often utilize iambic pentameter as their preferred metrical form.

The phrase refers to the meter, or rhythm, created by the words in that line; rhythm is measured in units called "feet," which are discrete groupings of syllables.

Hence, it can be seen that the given line makes use of iambic pentameter and the line length is in trimeter

Read more about iambic pentameter here:

https://brainly.com/question/1467813

#SPJ1

Was justice served in the murder trial of adnan syed? after listening to serial season 1 and reviewing related materials, write an essay in which you address this question and argue the effectiveness of his prosecution and defense. support your position by both directly citing and paraphrasing evidence from the podcast and related texts. be sure to refute competing views.

Answers

No, justice was not served in the murder trial of Adnan Syed as he was allowed to get free out of the bars by his last hearing by the judge in Baltimore.

Because of three things, Adnan Syed is not responsible for the death of Hae-Min Lee. Jay is a poor witness, Cristina Gutierrez, Adnan's attorney, failed to position him to win the case, and the window of time does not line up. He was, therefore, finally released and allowed to re-join his family after serving behind the bars for more than two decades then. Hence, justice was not served.

The most promising physical evidence against Adnan Syed was a fingerprint, or more specifically, a palm print, using a map. Officers discovered it in the backseat of Hae's car. It was one of those large map books you buy at a gas station. Adnan's left palm was partially imprinted on the back cover of the book.

To know more about hearing, refer to the following link:

https://brainly.com/question/29583565

#SPJ4

Write a Press Report about an accident you've witnessed 100-120 Words

Answers

This is something that you would need to write that has happened in your life.

Peter wrote his second letter as a [ Select ] ["welcome letter", "farewell letter", "promotional letter"] . Peter was in [ Select ] ["Jerusalem", "Antioch", "Rome"] when he wrote the letter. Later, he was executed by Emperor [ Select ] ["Pontius Pilate", "Cleopatra", "Nero"] . Peter wrote this letter to warn other Christians about [ Select ] ["false teaching", "conditions in Rome", "missionary trips"] .

Answers

The cause of the First Letter of Peter is exhortation directed to “the exiles of the Dispersion” in Asia Minor simply so they “stand fast” in God's grace withinside the face of persecution.

Peter emphasizes the position of apostles as selected via way of means of God to proportion his Gospel. Because of this, their persecution can surely be visible as a present as it gives them a risk to expose others the unexpected generosity and love of Jesus, that is fueled via way of means of desire in his go back and victory over evil. The Second Letter of Peter is basically worried with the Second Coming of Christ. The creator attributes the obvious postpone to God's staying power in permitting time for widespread redemption and notes that withinside the sight of God 1,000 years are like one day.

To learn more about redemption check the link below:

https://brainly.com/question/27760684

#SPJ4

describe how ozick presents the setting. why do you not receive a clear picture of how things look? why does ozick present the details as she does?

Answers

Ozick includes these details near the end of the story because he contrasts the beauty of the Meadows with the cruelty suffered by Rosa and millions of others at the hands of the Nazis.

Cynthia Ozick's The Shawl is about struggle, power, trust and innocence. After reading the narration, the reader realizes that Ozick may be addressing issues of conflict as it is narrated by an anonymous third-party narrator.

The first scene of the story features a woman with a young child and her three characters, including a boy walking beside her.

Thus, from Ozick's portrayal of her mother Rosa and the little girl Stella who accompanies them, readers quickly realize that their journey was not kind and left them weak and hungry.

Learn more about Cynthia Ozick here:

https://brainly.com/question/28261709

#SPJ4

not normal or usual; not following the usual rules about what should be done; not regular in form or shape

Answers

Not normal or usual; not following the usual rules about what should be done; not regular in form or shape Irregular .

Something that is unpredictable or uneven is described as irregular. If your dog has uneven patches, it indicates she has splotches of color all over her fur.

Anything that lacks a pattern or timetable is irregular, such as a store that is only open when the proprietor feels like it. An irregular segment of speech is one that does not follow the conventional norms of grammar.

Irregular can also refer to something that does not fulfill standards, such as discounted apparel. Irregular used to signify "not in accordance with Church norms."

Learn more about to regular ;

https://brainly.com/question/29722724

#SPJ4

in the autumn of 1874, the kiowas were driven southward toward the staked plains. columns of troops were converging on all sides, and they were bone-weary and afraid. which choice best conveys the connotative meaning of the word driven in this context?

Answers

The correct option (d) rounded up like cattle.

In addition to its explicit or precise meaning, which is its denotation, a connotation is a generally accepted cultural or emotional association that every particular word or phrase possesses.

A connotation is typically regarded as either good or negative in terms of the emotional connection it evokes.

A obstinate individual, for example, may be characterized as either strong-willed or pig-headed; while both have the same literal meaning (stubborn), strong-willed connotes admiration for the strength of someone's will (a positive connotation), whilst pig-headed connotes annoyance in dealing with someone (a negative connotation).

Learn  more about connotative meaning to visit this link

https://brainly.com/question/14712150

#SPJ4

Full Question: Read this passage from The Way to Rainy Mountain.

In the autumn of 1874, the Kiowas were driven southward toward the Staked Plains. Columns of troops were converging on all sides, and they were bone-weary and afraid.

Which choice best conveys the connotative meaning of the word driven in this context?

Ushered as visitors

led forward like horses

steered to a location

rounded up like cattle

Why most likely does shakespeare depict the two night watchmen in scene 1 discussing a spirit wandering around before dawn?

Answers

Particularly Horatio believes the ghost portends violence and unrest for Denmark, likening it to the paranormal signs that were said to have indicated the assassination of Julius Caesar in ancient Rome (and which Shakespeare had recently represented in Julius Caesar ).

The guards Francisco and Bernardo tell Hamlet's buddy Horatio about the ghost they saw that looks like his father on a gloomy, icy night. If the spirit returns, they get Horatio to come with them so they can try to communicate with it.

The Ghost is begged to stay and speak, but it vanishes into the darkness. Horatio is shocked to have seen the Ghost of King Hamlet clothed in the armor he wore when he overthrew the old King Fortinbras and defeated the Poles, claiming he would not have believed it if he had not seen it for himself.

To know more about Horatio, refer to:

https://brainly.com/question/6978768

#SPJ4

Read this excerpt from "a modest proposal" by jonathan swift: i can think of no one objection, that will possibly be raised against this proposal, unless it should be urged, that the number of people will be thereby much lessened in the kingdom. this i freely own, and 'twas indeed one principal design in offering it to the world. how does this excerpt contribute to the argument's impact?

Answers

The excerpt from "A Modest Proposal" by Jonathan Swift contributes to the argument's impact: Swift has made his argument, now he’s addressing possible responses.

An аrgument is аn intellectuаl process consisting of а connected series of stаtements thаt estаblish а proposition, thаt implies thаt а good аrgument hаs а structure. An аrgument’s structure consists of one or more premises аnd а conclusion.

An impact argument is а type of аrgumentаtion which seeks to compаre the impаcts presented in both cаuses аnd effects. In the excerpt above, the first sentence shows Swift's argument. And then, Swift is addressing possible responses in the second sentence.

Your question is incomplete, but most probably your full question was

How does this excerpt contribute to the argument's impact?

a. Swift had told the reader he has a proposal, now he’s stating it.

b. Swift has described the problem, now he’s making his argument

c. Swift has stated the problem, now he’s providing the reader with more details.

d. Swift has made his argument, now he’s addressing possible responses.

Thus, the correct answer is D.

For more information about arguments refers to the link:

https://brainly.com/question/415060

#SPJ4

At night or in poor visibility, loads extending four feet or more to the rear of a vehicle must have a red light that is visible for
a. 500 feet.
b. 200 feet.
c. 300 feet.
d. 400 feet.

Answers

At night or in poor visibility, loads extending four feet or more to the rear of a vehicle must have a red light that is visible for The right response is Option A) 500 feet.

A red flag must be used to designate weights that extend four feet or more to the rear of a vehicle throughout the day. The load must be indicated with a red light that is visible for 500 feet during the day and at night when visibility is low.

Objects on the road become indistinguishable from their surroundings at a distance of more than 300 metres due to poor vision, which may be temporarily caused by the weather or another phenomena (fog, rain, snow, snowfall, twilight, smoke, dust, water and mud splashes, sun glare);

To learn more about poor visibility. Please visit the below link.

https://brainly.com/question/2699737

#SPJ4

How is Santiago different from the shop's owner?


Santiago believes you should look around and follow the omens to improve business.


Santiago thinks the shop owner doesn't understand business and how to do the shop books.


Santiago shows the shop owner how to decline business to the point of closing the shop.


Both the shop owner and the boy believe that change is a bad thing.

Answers

The way in which Santiago is different from the shop's owner is A. Santiago believes you should look around and follow the omens to improve business.

What is a Narration?

This refers to the term that is used to describe and define the telling of a story with the aid of a narrator who helps to show the sequence of action to aid understanding and advance the plot.

Hence, it can be seen that in the book The Alchemist, there is the use of narration to describe Santiago and the shop owner as Santiago wants to change things, but the shop owner wants to keep things the same.


Read more about narration here:

https://brainly.com/question/1934766

#SPJ1

What does the urn in Ode on a Grecian Urn symbolize?

Answers

Keats engages the Grecian urn as a symbol of life. He refers to the Greek piece of art as being imperishable, accompanying allure communication stated to forever.

Moreover, in many ideas, the vessel is a symbol of death. It is trusted by many religions that the corpse is curved into dust as the soul floats continuously toward God. The adorned urn stresses this typology as it designates the death of one.

Keats specifies his response to a Grecian urn portrayed accompanying representations of a person who has not had pipers and additional Greeks. While the tune of new epoch pipes may be sweet, Keats finds the portrayed pipes more nice-sounding. They are not absolute erotic will but guide individuals to a bigger sense of ideal beauty.

To know more about Grecian urn refer to: https://brainly.com/question/30192610

#SPJ4

URGENT- I need help please English 12 final

Answers

Answer:

B most likely.

Explanation:

There’s an ELA standard that says: “Present claims and findings, emphasizing salient points in a focused, coherent manner with pertinent descriptions, facts, details, and examples…”(SL.6-7-8.4). What things do good speakers do to accomplish that?

Answers

Certain things that good speakers do to accomplish the ELA standard include; Getting quotes from experts in the field, citing historical events that connect to the subject being discussed, and including relevant data that support the main idea.

How do speakers accomplish present claims?

Speakers do not present their claims by simply telling their audience to believe what they are saying. They rather do this by being practical and finding relevant facts and figures that corroborate the claim that they make.

Quotes from an expert in the field can be cited and examples that are relevant could also be used for this purpose.

Learn more about ELA standards here:

https://brainly.com/question/27955048

#SPJ1

Why is my word dictionary not in English?

Answers

Check that perhaps the correct dictionary dialect site is handpicked for your text, such as English (United States) rather than English (United Kingdom).

What is the significance of the dictionary?

By ensuring that you use words correctly, a reference manual can help you better understand your subject, improve your communication, and improve your grades.

What are the advantages of using a dictionary?

The dictionary primarily aids in understanding the meaning of new words and their synonyms. The applicability of any word is impossible if you do not know the correct meaning; in that case, the syntactical application of the term will be known from the vocabulary.

To know more about dictionary visit:

https://brainly.com/question/1199071

#SPJ4

What element of a plot introduces the characters and setting of a story by the author?

Answers

The EXPOSITION element of a plot introduces the characters and setting of a story by the author.

The people, plot, and environment are all introduced in the EXPOSITION. It might also provide background data on these components.

The difficulty or obstacle the main character must overcome is known as the CONFLICT. If a character is having trouble selecting a choice, the conflict may be internal; alternatively, it may be external, with the character up against another person, society, or even nature.

The activities leading up to the climax are part of the RISING ACTION. These activities increase interest and excitement.

The story's action reaches its zenith at the CLIMAX. It is where the conflict's opposing forces come face to face or where significant decisions or actions are made.

The actions that occur after the climax are referred to as the FALLING ACTION.

How things work out in the end is the RESOLUTION.

To learn more about Element of a plot Please click on the given link:

https://brainly.com/question/12042775

#SPJ4

What are the characteristics of radical expressions?

Answers

An expression in mathematics known as a radical contains the radical sign. beneath it was a radicand. together with a degree to its left.

What does "radical expression" mean?

A radical expression is any expression in mathematics that uses the radical () sign. There will be a superscript number in the "V"-shaped portion of the sign when the radical symbol is used to represent any root other than a square root. To find the cube root of 8, for instance, enter 3(8).

The radical expression is therefore an expression that contains a square root. The radical symbol's "radicand" is a number or phrase. A radical equation is one that uses variables as radicands in radical expressions. Only if there is no radical in an expression can it be said to be simplified.

To learn more about square root, visit:

https://brainly.com/question/576611

#SPJ4

The three characteristics of radicals are is the  radical sign which is perhaps better known as the square root sign , the degree of the radical and the expression inside the square root which is called a radicand.

What is a Radical function?

Any mathematical expression that employs the radical (the square root symbol, ) symbol is referred to as a radical expression. When the radical symbol is used to indicate any root other than a square root, a superscript number appears in the left side of the sign near the 'v' shaped portion in the bottom.

What is the opposite of a radical ?

Exponents are the opposite of radicals and is a way of expressing repeated multiplications.

to learn more about square roots visit:

https://brainly.com/question/576611

#SPJ4

What urn was Keats writing about?

Answers

'Ode on a Grecian Urn' is individual of the five excellent odes Keats calm in the vacation and harvest of 1819.

The scenes on the urn describe a Classical world that has past beyond memory passed—and still, in being established on the urn itself, these settings too evoke a sense of immortality. The urn is thus a contradiction—its settings mention vibrant humanity and, cause they are stopped in time, appear to show a kind of eternal life.

"Ode on a Grecian Urn" was inscribed in 1819, the old age at which point Keats weakened infection. He told welcome companions that he sensed like a living devil, and it's not unexpected that the writing concede possibility be so desire with the plan of fame.

To know more about  Grecian Urn refer to: https://brainly.com/question/30125861

#SPJ4

elements of the speech communication process include

Answers

The seven factors withinside the speech method that observe to speech are: 1) speaker, 2) listener, 3) message, 4) channel, 5) interference, 6) feedback, and 7) situation.

The speaker is the supply of records and verbal exchange and is the character who offers or expresses their concept on a topic. While your organizational shape will range from speech to speech, there are despite the fact that 5 primary components of any speech: interest statement, introduction, body, conclusion, and residual message. Message, which is likewise called the issue be counted of this method, i.e., the content material of the letter, speech, order, records, concept, or suggestion. - Communication channel or the media thru which the sender passes the records and know-how to the receiver.

To learn more about communication check the link below:

https://brainly.com/question/26152499

#SPJ4

1
Select the correct text in the paage. Which detail from thi excerpt highlight that Gu i a loyal, caring friend?

Answers

In this sentence in the sixth section, Gus didn't focus anything on insults and slurs against himself, however, he profoundly loathed any idea of affront focused on his disabled companion," showing that Gus is a dedicated, caring companion.

Who is Gus?

Bill had over and over shown that he had a local mind and a tongue that could propose on par with what was at any point given to him, regardless of the way that he couldn't protect his standing with his clenched hands, a technique that Gus viewed as the most engaging.

How might I at any point bury the hatchet with you, Gus, considering where we are at present? Bi? l hollered as the young men moved toward the doorway, his brace and fortune crashing the steps.

Learn more about Gus:

https://brainly.com/question/27845858

#SPJ4

Other Questions
aamc 2022 free practice exam bbquestion a particular diploid organism is heterozygous in each of 3 unlinked genes. considering only these 3 genes, how many different types of gametes can this organism produce? Ah, happy, happy boughs! that cannot shed Your leaves, nor ever bid the Spring adieu; And, happy melodist, unwearied, For ever piping songs for ever new Write two to four sentences comparing the themes of the two poems. Use evidence from the texts to support your answer. The Cold War 4. Why is this sporting event (in the light of the Cold War conflict)? 8.why is it impossible for bruno to understand what is going on around him, even when shmuel tries to explain it to him? 30 POINTS ASAP America at the Turn of the Centuryadapted from the Library of Congress By 1900 the American nation had established itself as a world power. The West was won. The frontier was no more. The continent was settled from coast to coast. Apache war chief Geronimo had surrendered in 1886. Defeat of the Sioux at the battle of Wounded Knee in 1891 had brought the Indian Wars to a close. By 1900 American Indians were on reservations and the buffalo were gone. Homesteading and the introduction of barbed wire in 1874 had brought an end to the open range. The McCormick reaper had made large-scale farming profitable. In 1900, the U.S. was by far the world's largest agricultural producer. The first transcontinental rail link had been completed in 1869. Three decades later, in 1900, the nation had 193,000 miles of track, with five railroad systems spanning the continent. The world's first oil well had been drilled in Titusville, Pennsylvania, in 1859. By 1900, major oil fields were being tapped in Kansas, Illinois, Louisiana, Oklahoma, and Texas. The supply of American oil seemed limitless. John D. Rockefeller's Standard Oil Trust dominated the world's petroleum markets. It controlled more than 90 percent of the nation's refinery capacity. At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced. In the 1880s Andrew Carnegie had constructed the world's largest steel mill in Pittsburgh, Pennsylvania. By 1900, the United States was the largest steel producer in the world, turning out 10,000,000 tons a year. Henry Ford had built his first gasoline engine car in 1892 and the world's first auto race was held in Chicago in 1896. With the founding of the Ford Motor Company in 1903, the age of the automobile was underway. By 1900, telephones were in wide use. Cities were being electrified. Moving pictures were a curiosity. Guglielmo Marconi was conducting experiments that would lead to the development of the radio, and the Wright brothers were at work on a heavier-than-air flying machine. Cities were growing. New wealth and devastating fires produced a boom in urban construction. Architects Richardson, Hunt, McKim, Mead, and White flourished. Sullivan pioneered the skyscraper and his protg, Frank Lloyd Wright, was beginning his career in Chicago. This was a time of both confidence and ferment. In the cities and the states, political "Progressives" were coming to power, experimenting with reforms such as women's suffrage, direct election of United States senators, the initiative, recall, the Australian ballot, primary elections, and laws setting minimum wages, work standards, and regulated rates for common carriers and services. Followers of the Progressive movement believed in the perfectibility of man and his society. Republican William McKinley of Ohio was elected president in 1896 and re-elected in 1900. He had been preceded by Democrat Grover Cleveland. McKinley looked every inch a president. Young reporter William Allen White said of him after an interview: "He was the statue in the park speaking." A dignified, reserved man, McKinley was the last of the old-style, low-key presidents. McKinley was the last of five Civil War veterans to serve in the White House, signaling the end of the post-war era. He was also the fifth of the six Ohio presidents to serve during the fifty-year period 1868-1908. McKinley is generally considered to have been a good but weak man. He would be followedand overshadowedby Theodore ("Teddy") Roosevelt, who was vice-president when McKinley was assassinated in 1901. Later, Roosevelt would be elected president in his own right. The ascendancy of Ohio and the Midwest in national politics demonstrated that the United States was no longer a nation oriented to the Atlantic seaboard. It stretched, as the anthem, America the Beautiful, put it, "from sea to shining sea."Select all the correct answers.Read the sentence from "America at the Turn of the Century."At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced.Which three sentences correctly paraphrase the sentence?A. A nation's industry was considered powerful by the number of tons of steel it produced (Library of Congress). B. In the late 19th century, it was the amount of steel produced that showed how powerful a nation's industry was (Library of Congress). C. A nation's industry was considered powerful only if it managed to produce a large quantity of steel (Library of Congress). D. At the turn of the century, the number of tons of steel helped determine the strength of a nation (Library of Congress). E. The quantity of steel produced helped determine the strength of a national industry (Library of Congress). which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge? ache mothers, in paraquay, carry their young children almost all the time to protect them from getting hurt in the forest. consequently, their children walk almost a year later than american children. based on this example, do you think it is the impact of nature, nurture, both or neither that influenced this cultural difference? You develop and deploy several microservices to an Azure Kubernetes Service (AKS) cluster. The microservices are instrumented with the Application Insights SDK. You configure an Application Insights instance and use the connection string in the instrumentation.The instrumentation includes a custom telemetry value used to track the order checkout action. Order checkout is an action that includes a property to capture the order number.You need to capture the custom order telemetry.Which Application Insights data type should you use?Select only one answer.tracedependencymetricevent Otis wants to borrow 10000 to buy a used car. he examined his budget and decided that he can afford a payment of $200 a month. if his bank offers him a rate of 7.5%, how long should he borrow the money so he can afford his monthly payment? two harmonic waves are described by y1= (4m) sin (8/mx-300/s t) y2=(4m) sin (8/mx-300/s t-2) what is the wavelength of the resultant wave ? Below you will find the yearly average values of the Dow Jones Industrial Average, the most popular index of stock market prices, for five different years. The Consumer Price Index for each year (on a base of 1982- 1984 = 100) can be found on the inside back cover of this book. Use these numbers to deflate all five stock market values. Do real stock prices always rise every decade?Year Dow Jomes Industrial Average1970 7531980 8911990 2,8792000 10,7352010 10,663 DXL Practice with algebrai XDL | Identify equivalent in X Q Algebra It A Common Cor X DAt the start of the softball x GIdentify equivalent linear Xbd.com/math/grade-7/identify-equivalent-linear-expressions-word-problems?signinRedirect=https%3A%2F%2Fwww.ixl.com%2Fsignin%2 R.23 Identify equivalent linear expressions: word problems KWH>120xx + 1.2xSubmitAlec's parents give him x dollars per month for his allowance. However, since his birthday isin February, he gets an extra 20% bonus that month.Pick all the expressions that represent how much Alec's allowance is in February.x + 0.2x+1.2x*DX Consider the deflection (based on choices of E and I) and the weight of the material. How would you find a balance between the needed structural performance and weight? what decreases the possibility that errors will be caught and the potential for fraud will be increased? The measure of angle JKL is 145.The measure of angle MKL is 60.The measure of angle JKM is x.Find the value of x.X=0X5XK145M60D the dominican republic has 10.7 million people and a national population growth rate of 1.5 percent. paraguay has 6.8 million people and a national population growth rate of 1.5 percent. in how many years will each country double in size? sean is one of several general partners who own pints and cans, a small chain of bar and grills located in illinois and indiana. sean is interested in converting the partnership into a master limited partnership. if he convinces other partners to go along with his idea, pints and cans will select one: a. offer shares of ownership that are traded on a stock exchange much like a corporation. b. pay its taxes like a corporation. c. begin to operate much like a sole proprietorship. d. have to change its name to include the term ltd. in its title to indicate its owners have limited liability. this tissue type can perform absorption or secretion in the body. Culture is taught formally and informally. Identify the following sources as providing either formal or informal instruction. Did the Filipinos benefit from the political changes that the Spaniards introduced?