what is the midpoint between 1 + 9i and 5 - 3i?

Answers

Answer 1

Answer:

The midpoint between 1 + 9i and 5 - 3i is 3 + 3i

Given

Points 1 + 9i and 5 - 3i

To find Midpoint between given points

Solution

Midpoint is the average of the two points. Find it as follows:

(1 + 9i + 5 - 3i)/2 = (6 + 6i)/2 = 3 + 3i

Related Questions

PLEASE HELP ME WITH THIS MATH PROBLEM!!

Answers

Step-by-step explanation:

in general we would need a probabilty table or a probability calculator service on the internet.

but in this case we know.

the man value is 64. and the standard deviation is 6.

so, one standard deviation +/- interval from the mean value is 70 and 58.

and the interval of 2 standard deviations from the mean value is 76 and 52.

and 64 and 76 are exactly the limits we are asked for.

so, remember the normal distribution rule :

68% are within 1 standard deviation.

95% are within 2 standard deviations.

99.7% are within 3 standard deviations.

and 50% are below (and also above) the mean value.

so, we know, 50% of the 350 (= 175) students scored below 64.

95% of the students scored between 76 and 52. as there are 5% left, half of these 5% (= 2.5%) scored even below 52).

so, 95% + 2.5% = 97.5% of the 350 (= 341.25) students scored below 76.

therefore, the number of students that scored between 64 and 76 is

341.25 - 175 = 166.25 ≈ 166

32 divided by 4x [16x1/2]-2

Answers

64x x [x] -2

Steps
1. Cancel out the greatest common factor

2. Calculate the absolute value

3. Calculate the quotient

4. Calculate the product

5. And then you get your solution 64x x [x] -2

Round 508.0219 to the nearest hundredth

Answers

Answer:

508.02

HOPE THIS HELPS

Todo <3

Step-by-step explanation:

Which ordered pair is not a solution of the linear equation shown?
1
y=-x
2
OA) (2, 1)
B) (1.-—-)
1,
2
OC) (4,8)
OD) (-2,-1)

Answers

Answer:

C  : (4,8)

Step-by-step explanation:

The equation y = (1/2) x

Or, 2y = x ==> x = 2y
means that, for any value of x, the y value must be one-half that value or, in other words, for any value of y, x must be twice the value of y

A, B and D will satisfy the above equation if you plug in values of x and y given

In C we have x = 4 and y =8 so x = y/2 NOT 2y

(c) Given that the average speed for the entire journey was 80 km/h, form an equation in x and solve the equation.​

Answers

Answer:

80x = y

Step-by-step explanation:

A camper ties a rope from a tree to the ground to help build a shelter. The rope is 8 feet long, and it is tied 6 feet up the tree. How far from the tree is the rope anchored to the ground? Use the Pythagorean theorem to find the answer.

Answers

Answer:

≈5.3 feet,63.6 inches

Step-by-step explanation:

36+b²=64

-36 -36

b²=28

if we square root both sides we can get the radical/exact answer or the rounded one

radical: 4√7

rounded to the nearest tenth: 5.3 feet

a) Write 2 expressions for the area of the shaded region.
b) Find the length of the shaded region if the perimeter is 48cm.
c) Find the area of the shaded region if perimeter is 48cm.

Answers

Answer:

(a)9×3=37' 97 and 8 are factors of 37

Given lJK , which is an isosceles right triangle, IJ=4 and m

Answers

As IJK is isosceles

IJ=JK

Hypotenuse must not counted counted among equal sides so

IK²=2(LJ)²

Apply roots

IK=LJ√2

Option C

What is (-2)-(-2 1/6) and how do i get that answer?

Answers

Answer:

1/6

Step-by-step explanation:

-2 - (-2 1/6)

multiply the number in the parentheses by -1

-2 + 2 1/6

-2 + 2  cancels out

Leaving 1/6 as your answer.

Can I add [tex]2\sqrt{3} + 5\sqrt{3}[/tex] further?

Answers

Yes, they can be added and simplified further. 2√3 + 5√3 = 7√3 .

Take √3 as common factor:

2√3 + 5√3

(2 + 5)√3

7√3

The two irrational numbers sums to form another irrational number 7√3 . In decimals that is 12.12435...

[tex] \sf{\qquad\qquad\huge\underline{{\sf Answer}}} [/tex]

Yes, The terms assigned above are alike so they can be added easily by simple algebric method where root number can be treated as a variable.

[tex]\qquad \sf  \dashrightarrow \: 2 \sqrt{3} + 5 \sqrt{3} [/tex]

[tex]\qquad \sf  \dashrightarrow \: (2 + 5) \sqrt{3} [/tex]

[tex]\qquad \sf  \dashrightarrow \: 7 \sqrt{3} [/tex]

tGive the values of a, b, and c from the standard form of the equation (2x + 1)(x - 2) = 0.

Answers

Answer:

a = 2

b = -3

c = -2

Step-by-step explanation:

The standard form of a quadratic equation:

ax² + bx + c = 0

…………………………

in order to determine the equation

in standard form ,we have to expand the given expression :

(2x + 1)(x - 2) = 2x² - 4x + x - 2

                     = 2x² - (4x - x) - 2

                     = 2x² - 3x - 2

Then the standard form is :

2x² - 3x - 2

Doubling the dimensions of a rectangle increases the area by a factor of 4.

If p represents doubling the dimensions of a rectangle and q represents the area increasing by a factor of 4, which are true? Select two options.

Answers

p → q  represents the original conditional statement and the contrapositive of the original conditional statement. Then the correct options are A and E.

The missing options are given below.

What is dilation?

Dilation is the process of increasing the size of an item without affecting its form. Depending on the scale factor, the object's size can be raised or lowered.

There is no effect of dilation on the angle.

Doubling the dimensions of a rectangle increases the area by a factor of 4.

If p represents doubling the dimensions of a rectangle and q represents the area increasing by a factor of 4.

Then the true statement will be

Then the correct options are A and E.

More about the dilation link is given below.

https://brainly.com/question/2856466

#SPJ1


Using the relationships between
perpendicular lines and their slopes, explain
why horizontal and vertical lines will always
be perpendicular.
Be sure to include the slopes of horizontal
and vertical lines as part of your answer

Answers

Answer:

They will always intersect at one point

Step-by-step explanation:

^^

Write the algebraic expression for the following statement.

A number decreased by 7 is 5.

Answers

Answer:

the algebraic expression is ; x-7=5

Two friends, Vani and Shaquana, took summer jobs. The equation y=28.8xy=28.8x represents Vani's earnings in dollars and cents, yy, for working xx hours. Shaquana earned $653.40 in 33 hours.
How much less per hour does Shaquana earn than Vani?

Answers

An equation is formed of two equal expressions. Shaquana earns $10 less per hour than Vani.

What is an equation?

An equation is formed when two equal expressions are equated together with the help of an equal sign '='.

The equation y=28.8x represents Vani's earnings in dollars and cents, y, for working x hours.

y = 28.8x

y/x = 28.8

Hence, Vani is paid $28.8 per hour.

The amount that Shaquana earned was $653.40 in 33 hours. Therefore, per hour she was paid

Amount per hour = $653.40/33 = $19.8 per hour

The difference between the two is,

Difference = $28.8 - $19.8 = $10

Hence, Shaquana earns $10 less per hour than Vani.

Learn more about Equation:

https://brainly.com/question/2263981

#SPJ1

Vani - 28.8

y=28.8x

Vani earns $28.80 per hour.

Shaquana -

653.40 / 33 = $19.80 per hour

Shaquana earns $19.80 per hour.

Vani − Shaquana = $28.80

$28.80−$19.80

=$9

Shaquana earns $9 less per hour than Vani.

How is the graph of the parent function y = x squared transformed to produce the graph of y = 3 (x + 1) squared?
It is translated 1 unit right and compressed vertically by a factor of 3.
It is translated 1 unit left and compressed vertically by a factor of 3.
It is translated 1 unit right and stretched vertically by a factor of 3.
It is translated 1 unit left and stretched vertically by a factor of 3.

Answers

Answer:

D.

Step-by-step explanation:

Select all that apply. Which of the following corresponds to absolute zero?

Answers

In thermodynamic system, Absolute Zero is that temperature implies Lowest energy level i.e.  option a) 0 K or -273° C.

What is Absolute Zero?

Absolute Zero can describe as,  in  a thermodynamic system, there are certain energy levels depending upon the potentials of temperature. At Absolute zero the potentials of temperature  are  0 K in Kelvin scale and   -273° C in Celsius scale.

The question seem's to be incomplete. The option could be.

a) 0 K and -273° C
b) 273 K and 0° C
c) -273 K and 0° C
d) 0 K and 273° C

Hence, As per theory Value of The absolute zero is 0 K and -273° C

learn more about temperature scale's:
https://brainly.com/question/18837348

#SPJ1

Use the FOIL method to evaluate the expression:

Answers

Answer:

[tex]\sf b.) \ 1 +2\sqrt{7}[/tex]

Explanation:

Foil method: (a + b)(c + d) = ac + ad + bc + bd

Solving steps:

[tex](4 - \sqrt{7} )(2 + \sqrt{7} )[/tex]

[tex](4)(2) + 4(\sqrt{7} ) + (-\sqrt{7} )(2) + (-\sqrt{7} )(\sqrt{7} )[/tex]

[tex]8 + 4\sqrt{7} - 2\sqrt{7} - 7[/tex]

[tex]8 -7 + 4\sqrt{7} - 2\sqrt{7}[/tex]

[tex]1 +2\sqrt{7}[/tex]

option b) 1 + 27

Step-by-step explanation:

Foil property method :-

[tex] \red{ \boxed{ \orange{ \rm (a + b)(c + d) = ac + ad + bc + bd}}}[/tex]

then, on substituting the values,

[tex]\sf⇒ \:  \: 8 + 4 \sqrt{7} - 2 \sqrt{7} - 7[/tex]

[tex]\sf⇒ \:  \: \green{ \underline{\bold{ \red{1 + 2 \sqrt{7} }}}}[/tex]

In the diagram below, Θ is measured in radians. Which equation represents the relationship between the radius, r, and arc length, s?

Circle O is shown. Line segments A O and B O are radii with length r. Angle A O B has a measure of theta. Arc A B has a measure of s.

s = Θ · r
r = Θ · s
s = Θ + r
r = Θ + s

Answers

The equation that represents the relationship between the radius, r, and arc length, s is s = Θ * r

How to determine the arc length?

The attached image completes the question

The given parameters are:

Angle = ΘRadius = r

Since, the angle is in radians.

The arc length is calculated as:

Arc length = Angle * Radius

So, we have:

s = Θ * r

Hence, the equation that represents the relationship between the radius, r, and arc length, s is s = Θ * r

Read more about arc lengths at:

https://brainly.com/question/2005046

#SPJ1

Work out the bearing of Y from W.
(Not drawn accurately)

Answers

Answer:

206°

Step-by-step explanation:

The bearing of y from w is the angle y makes with w moving from the north pole in clockwise direction.

So from the north pole, move in clockwise direction and stop at the line joining w and y

the angles there are 90+116= 206°

Therefore the bearing of Y from W is 206°

albert worked for 8 hours and earned $24. how much does albert earn for 24 hours

Answers

Answer:

$72

Step-by-step explanation:

The following data table represents the total cost of a monthly cell phone bill as a function of the number of minutes that the phone is used each month. Minutes 500 750 1,000 1,250 1,500 Total Monthly Cost (in dollars) $62 $77 $92 $107 $122Choose the correct linear model that represents the total monthly cost as a function of time. A y = 0.06 x + 500, B y = 16 x + 32,C y = 62 x + 16, D y = 0.06 x + 32 .

Answers

Answer:

ytyt

Step-by-step explanation:

tyt5667

Question 3(Multiple Choice Worth 5 points)
(06.03 LC)
Determine the equation of the graph, and select the correct answer below.
(-1, 3)

Answers

The answer is c because

The summer solstice can occur on any day of the week, with each day being
equally likely. What is the probability the summer solstice will occur on a
weekday?
О А.
O B.
7
115
517
O C.
O D. 1/1/20

Answers

The probability that the summer solstice will occur on a weekday is equal to 5/7.

How to calculate the probability?

Generally, there are seven days in a week and two among these days are weekends while five are weekdays. Thus, this can be represented as follows:

Total number of days = 7.Number of weekends = 2.Number of weekdays = 5.

Therefore, the probability that the summer solstice will occur on a weekday is given by:

P = 5/7.

Read more on probability here: https://brainly.com/question/12801413

#SPJ1

Lindsey is a member of the swim team at a local university. She has been working hard to perfect her dive for an upcoming swim meet. Lindsey's dive can be modeled by the quadratic equation y = – 16x2 + 33x + 45, where x is time in seconds, and y is Lindsey's height in the air in feet.

1. At what time will Lindsey be 30 feet in the air?

2. How high is the diving board? Explain your thinking.

Answers

Answer:

1. [tex]x = 2.45s[/tex]

2. The diving board is 45 ft high.

Step-by-step explanation:

• When Lindsey is 30 feet in the air, y = 30.

[tex]30 = -16x^2 + 33x +45\\\\-16x^2 + 33x +15 = 0\\\\16x^2 - 33x -15 = 0\\[/tex]

Using quadratic formula, solve for x:

[tex]x = \frac{33 + \sqrt[]{(-33)^2 - 4(16)(-15)} }{2(16)}[/tex]

[tex]x = 2.45s[/tex]

• If we calculate the height of Lindsey in the air when she is standing on the diving board, we can find the height of the diving board above the ground.

When she is standing on the board, x = 0 as no time has passed after jumping.

[tex]y = -16(0)^2 + 33(0) +45\\\\y = 45 ft[/tex]

find the pattern of 1,2,6,18 and state if its arithmetic or geometric

Answers

Answer:

 its a geometric sequence where each term is 3 times the previous term.

Step-by-step explanation:

{2,6,18,54,162,486,1458...}

A school is watching students as they enter the football game for students who are dressed
inappropriately. they estimate that 7% of all students are dressed inappropriately. out of a group
of 40 students, what is the probability that exactly 2 are dressed inappropriately? round to 3 decimal places.

Answers

Using the binomial distribution, it is found that there is a 0.242 = 24.2% probability that exactly 2 are dressed inappropriately.

What is the binomial distribution formula?

The formula is:

[tex]P(X = x) = C_{n,x}.p^{x}.(1-p)^{n-x}[/tex]

[tex]C_{n,x} = \frac{n!}{x!(n-x)!}[/tex]

The parameters are:

x is the number of successes.n is the number of trials.p is the probability of a success on a single trial.

The values of the parameters are given as follows:

n = 40, p = 0.07.

The probability that exactly 2 are dressed inappropriately is given by P(X = 2), hence:

[tex]P(X = x) = C_{n,x}.p^{x}.(1-p)^{n-x}[/tex]

[tex]P(X = 2) = C_{40,2}.(0.07)^{2}.(0.93)^{38} = 0.242[/tex]

0.242 = 24.2% probability that exactly 2 are dressed inappropriately.

More can be learned about the binomial distribution at https://brainly.com/question/24863377

#SPJ1

Please help fast, thank you! I only have 20 minutes! I always appreciate your help!

Answers

Answer:

ur missing the question

Step-by-step explanation:

Ware is the question

Which numbers are the extremes of the proportion shown below?
3-604
=
8
A. 3 and 8
B. 3 and 6
C. 4 and 6
D. 4 and 8

Answers

Answer:

A 3 and 8

Step-by-step explanation:

if a/b=c/d, the extremes are "a" and "d". The means would then be "b" and "c"

The extremes of the proportion are 3 and 8.

To find the extremes of a proportion, we need to identify the numbers that are positioned at the far ends of the proportion. In the given proportion:

3/4 = 6/8

The numerator of the first fraction, 3, and the denominator of the second fraction, 8, are the extremes. These numbers form the far ends of the proportion.

Therefore, the extremes of the proportion are 3 and 8.

Learn more about proportion click;

https://brainly.com/question/31548894

#SPJ7

please help me find the HCF of this​

Answers

Answer: a

Step-by-step explanation:

[tex]a^{2}=a \cdot a\\a^{2}+ab=a(a+b)[/tex]

Therefore, the HCF is a.

Answer:

a

Step-by-step explanation:

Factorizing both terms :

a² = a × aa² + ab = a × (a + b)

The HCF of the terms is a.

Other Questions
Which of the following is not a constitutional role of the president? (3 points) Which of these will complete the simple sentence?Mee Younga. was a great math student, but she did notenjoy her English classes as muchb. and Henry practiced for their duet for hoursAc. got sick right before the performance;however, she was able to complete her solonone of thesePlease select the best answer from the choices providedBd. none of these If 1 < a x , then the minimum value of [tex] \rm log_{a}(x) + log_{x}(x) [/tex] is ?PLEASE HELP!!!! how to solve superstition In the decade between 1882 and 1892, lynching rose in the South by an overwhelming 200 percent, with more than 241 black people killed. Lynching was used as a means of social control to terrorize and intimidate blacks. Which cultural myth was used to justify and legitimate the practice of white mobs lynching black people Juan is learning about like terms in his math class. He must check all the combinations below that are like terms which ones should he check What is the value of p? essay on depending on other countries very harmful to us James has $1500 to open a checking account. He can maintain a monthly balance of at least $1000. He plans to use the ATM four times per month at his local branch. He does not overdraft his account and plans to use direct deposit. He also plans to pay his bills online and he averages 8 bills per month. Bank Account Terms and Conditions James wants an account with the lowest fees. Which checking account would be best for James A recent order for 15,000 items of building supplies was composed of bolts and nails. Nails cost 5 cents each. The entire order arrived at an expense of 1500 dollars. If there were 2500 bolts, what is the cost of each bolt? Which factor contributed to European global exploration during the 15th to18th centuries? D 37 = 40D = Check your solution. 37 = 40 The boys (clean) the car. It looks new again. Problem 4 (a) three friends are packing sweets into gift boxes. they agree that each box should contain the same number of sweets, but they are each working in separate locations with their own pile of sweets so cannot share boxes. gwen has 286 sweets, bill has 390 sweets and zeta has 468 sweets. if they put the largest number of sweets into each box that they can and they use up all their sweets, how many boxes of sweets will they pack? (b) use the euclidean algorithm to find the highest common factor of 8008 and 24255 (you need to show all working). Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom why Germany was fertile soil for the Nazis following World War I? To learn by rote and imitation signifies: Group of answer choices Precomposed tradition Absolute Tradition Oral tradition Programmatic tradition three interior angles of a quadrilateral measure 55 , 117 , and 120. what is the measure of the fourth interior angle? Write a system of equations that could be used to solve the situation described below.You find 12 coins under the couch. Every coin is either a nickel or a penny, and they add up to a total of 32 cents. How many of each type of coin do you have? Let x represent the number of pennies and y represent the number of nickels.Please select the best answer from the choices providedA. x+y=12 0.05x+0.01y=0.32B. x+y=0.32 0.01x+0.05y=12C. x+y=12 0.01x+0.05y=0.32D. not enough information my guy friend is asking me if he dated a they/them, would that make him g.ay? If you was a trans male, I didn't know the answer and my friends were ghosting me, can anyone help?