Answer:
714.44
Explanation:
First do 674x106 which is 71444. Then add in your decimal point which has two numbers after it so add it in the same spot from the right.
Answer:
0.063584906
Explanation:
Divide 6.74/ by 106= 0.063584906
What do the segments of a transmembrane protein that cross the lipid bilayer usually consist of?Choose one:an α helix with mostly nonpolar side chainsa β sheet with mostly polar side chainsan α helix with mostly polar side chainsa β sheet with alternating polar and nonpolar side chains
Answer:
α helix with mostly polar side chains
Explanation:
Alpha helix with mostly polar side chains allow is a segments of transmembrane protein that cross the lipid bilayer because the helical structure of α helix provide wat is needed by the hydrogen bonds backbone internally and ensuring that there is no polar groups that is on exposure on the membrane if the side chains are all hydrophobic i.e the molecules repel water.
a. How many times its own weight did the moss absorb?
b. How does this compare with the paper towel?
c. Why is Sphagnum often used to ship items that must be kept moist?
Answer:
The correct answer is :
1. many times
2. absorbs more than paper towels.
3. It absorbs any extra water that is around.
Explanation:
mosses are non-vascular plants in the land plant division Bryophyta. They are little herbaceous plants that retain water and other nutrients with the help of their leaves and uses carbon dioxide and daylight to make food by photosynthesis. The sphagnum cells are very thin wall cells with enormous depressions or cavities which is uses as is to retain and ship water
Thus, the correct answer is :
1. many times
2. absorbs more than paper towels.
3. It absorbs any extra water that is around.
Why doesn’t the water heat up as much as the brick?
Answer:
Water is not a conductor of heat
Explanation:
How might you go about explaining the problem of climate change to friends and family? How could you encourage them to take climate action?
Answer:
Can you explain to them why it is not a hoax, because some people believe it is.
**ENVIRONMENTAL SCIENCE QUESTION** If an area is expected to double in population, how can we apply environmental science to the solution of the problem which is, if we have more population, we would need more buildings (homes, schools, stores, etc), which would then interfere with the removal of habitats. How would we apply environmental science to try and create a solution to stop that?
Answer:
no idea
Explanation:
need points
Where did all the matter that made up the solar system come from?
Answer:
Our solar system formed about 4.5 billion years ago from a dense cloud of interstellar gas and dust. The cloud collapsed, possibly due to the shockwave of a nearby exploding star, called a supernova. When this dust cloud collapsed, it formed a solar nebula—a spinning, swirling disk of material.
Credits to: NASA
My Answer to it:
If we want to know how our solar system began, we would first look at how it all started, as in the universes and matter. This is tied into the Big Bang Theory, which is proposed by scientists the explains causes to why the universe formed. In the theory, it states that all of the current and past matter in the universe came into existence at the same time, roughly 13.8 billion years ago. At this time, all matter was compacted into a very small ball with infinite density and intense heat called a Singularity. As time went on, it started to expand and started to cool off to allow the formation of subatomic particles, and later simple atoms. Giant clouds of these primordial elements later coalesced through gravity to form stars and galaxies.
Who is the hottest girl in the world
Answer:
most definitely not you
Explanation:
everyone is equally beautiful.
If a star is shown to be 33.11 trillion kilometers away, how many light years would that be?
Answer:
Answer:The definition I found is: 1 light year = 9.4605284 x 10¹⁵ ... If a star is shown to be 33.11 trillion kilometers away, how ...
Answer:
I think it would be around 3.5 lightyears if i remember correctly.
Explanation:
The narrow region between the head and diaphysis of a long bone is called the___________.
A) sulcus
B) trochlea
C) neck
D) canal
E) ramus
The narrow region between the head and diaphysis of a long bone is called the canal.
What is diaphysis?The diaphysis is also called the shafts which are the main portions of a long bone. A bone that is longer than its width and provide most of their length.
Canal is present between the head and diaphysis of a long bone which is a narrow region so we can conclude that the narrow region between the head and diaphysis of a long bone is canal.
Learn more about canal here: https://brainly.com/question/1920109
What Is the variable that stay the same in experiment
Answer:
The Constant
Explanation:
Answer:Independent Variable
Explanation:
Because it's independent and doesn't depend on something else.
An experiment is conducted in which the height of the ramp is changed and the speed of the skateboard down the ramp is measured. Which of the following correctly describes the speed of the skateboard down the ramp in this experiment?
Select one:
a. The manipulable (independent) variable
b. A constant
c. The responding (dependent) variable
d. A standard of comparison
Answer:
The responding (dependent) variable
Explanation:
In an experiment, one of the variables is either changed/maipulated or measured. The variable that is deliberately changed is called the INDEPENDENT VARIABLE while the variable that responds to the changes made to the independent variable, or is being measured is called DEPENDENT VARIABLE.
Hence, in the experiment involving the height of the ramp and the speed of the skateboard, the SPEED OF THE SKATEBOARD IS THE DEPENDENT/RESPONDING VARIABLE because it is the variable being measured.
Why is a compass important to marine science?
Answer:
( in the explanation )
Explanation:
The magnetic compass was an important advance in navigation because it allowed mariners to determine their direction even if clouds obscured their usual astronomical cues such as the North Star. It uses a magnetic needle that can turn freely so that it always points to the north pole of the Earth's magnetic field.
please helps .-.
which of these events had at LEAST effect on the history of life on earth?
A. Global climate change
B. Mountain building
C. Changes to the genetic code
D. Meteor or asteroid impacts
How do limiting factor determine the carrying capacity of an ecosystem
Answer:
Ecosystems only have so much food, water, space, and other resources. When different types of organisms all live in these areas, theres only so much that can go around.If an ecosystem has more organisms than its water supply can support then it is beyond its carrying capacity. The ecosystem will not be able to support the organisms and they will have to either relocate or die until the ecosystem is once again at or below carrying capacity.
The carrying capacity of an ecosystem is directly proportional to the limiting factors. Limiting factors increase, carrying capacity of an ecosystem increases.
What is Carrying capacity?Carrying capacity may be defined as the maximum number of an individual that can be supported by a habitat. The carrying capacity of any habitat depends on the following two factors:
The food to eat.The space to live.When limiting factors such as food, space, water, nutrients, etc. in a habitat increase, the carrying capacity of the habitat will definitely increase. This situation remains the same until there will be a scarcity in all those limiting factors suffered by a habitat.
When the limiting factors decline, the carrying capacity of the habitat ultimately lowers.
Therefore, it is well described above.
To learn more about Carrying capacity, refer to the link:
https://brainly.com/question/26660965
#SPJ6
Mr. Wang works in a recycling center. Recyclable materials arrive at the
center mixed together. Workers use magnets to separate steel cans from
other items. Which two statements are true about the force between a steel can and a magnet?
1 Gravity pushes the can toward the magnet.
2 The force between the can and the magnet is a noncontact force.
3 The attraction between the can and the magnet is a pull.
4 The attraction between the can and the magnet is a push.
Answer: The answer is number 2 and number C
Explanation: BECAUSE
The attraction between the can and the magnet is a pull is true statement about the force between a steel can and a magnet. Thus option 3 is correct.
What is force ?Force can be defined as an interaction which can change the motion of an unopposed object, it is the push or pull mechanism experienced by any object, a vector quantity, so it has both magnitude and direction.
Force can be up two types such as Contact Force can be applied to the objects by bringing them into contact, three subtypes of contact force are Frictional force, Applied force, Normal force.
Non-Contact Force applied to the body without any contact, for example Gravitational force. The SI power unit of force is the Newton(N).
When the force increases, the speed of a moving object or stationary object is also increased, the effect of force can also change the direction, shape and size of the object.
Learn more about controllable force , here:
https://brainly.com/question/14317715
#SPJ2
Albino alligators are alligators that lack the ability to produce melanin in their skin. This genetic defect gives their skin a yellowish-white appearance and the eyes generally cast a pinkish hue due to the visible blood vessels in the colorless irises.
Which biomolecule is represented in this example?
Answer: The biomolecule is a protein (more exactly, an enzyme) called tyrosinase.
Explanation:
First, a biomolecule is a molecule present in living organisms, we usually can separate them into 4 groups:
Carbohydrates, lipids, proteins, and nucleic acids.
Ok, albinism is the lack of melanin pigment (and the incapacity of producing it)
The first step to synthesize melanin is the conversion of tyrosine to dihydroxyphenylalanine, catalyzed by an enzyme called tyrosinase, then the lack of the biomolecule causes albinism.
Then here we are talking about an enzyme, and enzymes are proteins that work as biocatalysts.
Then the biomolecule represented in this example is a protein.
why did the chicken cross the road
Answer:
to get to the other side
Explanation:
why the fk else would the chicken cross the road
Question 15
The movement of water across a cell membrane is active transport and requires a lot of energy.
True
O False
Answer:
True
Explanation:
What criteria is used to divide the
earth into layers?
A. Each layer is 10 miles thick.
B. Each layer is 100 miles thick.
C. The age of the rock is determined.
D. It is based on physical and chemical properties.
1. What cell structures did you place in the plant cell that you did not place in the animal cell?
The plastids, chloroplasts and the cell wall is present in the plant cell but is not present in the animal cell.
What is the difference between plant and animal cells?The difference between plant and animal cell is the presence of certain organelles that is present in one cell and absent in another cell. Plants' cell have a cell wall, along with chloroplast and other specialized plastids, and a large central vacuole, which is not commonly found in animal cells. The cell wall is surrounded by a rigid covering that protects the cells also provides structural support and gives shape to the cell. Chloroplast is present in the plant cell but is not present in the animal cell. The purpose of the chloroplast is to make sugar. Photosynthesis is the process of a plant taking energy from the Sun and creating sugars. The cell walls, plastids, and chloroplasts are present in the plant cell but are not present in the animal cell.
So we can conclude that the chloroplast is present in the cell of the plant but is not present in the cell of the animal.
Learn more about Plant Cell here: https://brainly.com/question/913732
#SPJ1
When Amanda added table salt to the first test tube and shook it, she noted that the liquid had dissolved the
This question is incomplete because the options are missing; here is the complete question:
When Amanda added table salt to the first test tube and shook it, she noted that the liquid had dissolved the
A. Solute
B. Acid
C. Solvent
D. Base
The correct answer to this question is Solute
Explanation:
Amanda's experiment involves adding a solid (salt) into a liquid and then mixing both to form a mixture categorized as a solution because one substance has disintegrated in another. Moreover, in this mixture, the liquid is considered as the solvent because this dissolves or disintegrates the salt and the salt is considered as the solute (substance dissolved). In this context, the liquid dissolved the salt or solute in Amanda's solution or mixture.
What is the maximum number of individuals who could be represented by these bones? Explain your answer. (Hint: Assume every bone in the collection could be from a different person.)
Osteologists determine the maximum number of individuals based on the total number of pieces found in the remains. In the exposed example, the maximum number of individuals represented by these bones is 22.
-------------------------------------------------------
There is a protocol to follow when finding bones together or close to each other.
1) Bone's identification. To know which bone each of the pieces represents.
2) Classification of the bone's origin to know if bones belong to an animal or a human being.
3) Then the potential number of individuals found should be estimated. This step is one of the most significant ones for osteologists: determine the number of individuals found.
The minimum number of individuals the remains representThe maximum number of individuals the remains representBones might represent as many individuals as pieces there are. Or as many individuals as pieces can form by assembling them.
For instance, if a right femur and a right tibia are found together, the minimal number of individuals is one -because they could belong to the same person-, and the maximum number is two -because each of the bones could belong to a different person-.
Bone's characteristics such as sizes, bilateral traits, staining properties, articular matching, among others, are significant when trying to assembly an individual. However, these clues are not definitive.
Previous data can also be helpful when determining the number of individuals represented by these bones. Knowing the number of dead individuals in this place, ages, sexes, races, etcetera, can make the determination easier.
The most defining analysis to be performed when possible is DNI. A more confident determination on the number of individuals can be done by performing DNI analysis.
In the exposed situation there are 22 pieces, identified as follows
3 skulls6 femurs → 4 of them are right femurs2 right humerus 2 left tibia 4 hip bones → 3 left and 1 right5 scapula → 3 right and 2 leftAccording to this information, the first assumption should be that each piece of bone represents one single individual.
So, if there are 22 pieces, they might be representing 22 different individuals. This is the maximum number of individuals there might be present.
Since there are four right femurs, we could assume a minimum number of 4 individuals represented by these bones.
------------------------------------------------
Related link: https://brainly.com/question/22401870?referrer=searchResults
https://brainly.com/question/13403950?referrer=searchResults
Which of the following is a function of lipids in a cell?
They function in cell movement.
They are the components of cell membranes.
They form polysaccharides.
They produce enzymes.
Answer:
components of cell membranes
Answer:
b
Explanation:
Give an example of a endangered species due to invasive species and EXPLAIN why it’s in danger
Answer:
Explanation:
Invasive species are among the leading threats to native wildlife. Approximately 42 percent of threatened or endangered species are at risk due to invasive species.
Human health and economies are also at risk from invasive species. The impacts of invasive species on our natural ecosystems and economy cost billions of dollars each year. Many of our commercial, agricultural, and recreational activities depend on healthy native ecosystems.
What Makes a Species "Invasive"?
An invasive species can be any kind of living organism—an amphibian (like the cane toad), plant, insect, fish, fungus, bacteria, or even an organism’s seeds or eggs—that is not native to an ecosystem and causes harm. They can harm the environment, the economy, or even human health. Species that grow and reproduce quickly, and spread aggressively, with potential to cause harm, are given the label “invasive.”
An invasive species does not have to come from another country. For example, lake trout are native to the Great Lakes, but are considered to be an invasive species in Yellowstone Lake in Wyoming because they compete with native cutthroat trout for habitat.
How are animal cells different from plant cells
Answer:
Any of the below.
Explanation:
- Animals cells do not have cell walls, but plants cells have cell walls.
- Animal cells have many tiny vacuoles, but plants cells has one big vacuole.
- Animals cells do not have chloroplasts, but plants cells may have chloroplasts.
- Animal cells have centrioles.
Answer:
Animals cells do not have cell walls, but plants cells have cell walls. Animal cells have many tiny vacuoles, but plants cells has one big vacuole. Animals cells do not have chloroplasts, but plants cells may have chloroplasts. Animal cells have centrioles.
Explanation:
same thing otherr guy said but its easier to copy/paste onto edge2020
Which material undergoes radioactive decay?
A material undergoes radioactive decay if it has an atom with unequal number of protons and neutrons.
What is an atom?
An atom is defined as the smallest unit of matter which forms an element. Every form of matter whether solid,liquid , gas consists of atoms . Each atom has a nucleus which is composed of protons and neutrons and shells in which the electrons revolve.
The protons are positively charged and neutrons are neutral and hence the nucleus is positively charged. The electrons which revolve around the nucleus are negatively charged and hence the atom as a whole is neutral and stable due to presence of oppositely charged particles.
Atoms of the same element are similar as they have number of sub- atomic particles which on combination do not alter the chemical properties of the substances.
Learn more about atom,here:
https://brainly.com/question/13654549
#SPJ2
The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces)
Answer:
LVAAMQLLLLLFLLLFFLV
Explanation:
Transmembrane domains are hydrophobic regions inserted into the cell membrane, while surrounding protein regions are often designed to localize on opposite sides of the membrane. In general, hydrophobic amino acids are inserted into the hydrophobic core of the membrane. These hydrophobic residues have side-chains which are insoluble in water. Examples of hydrophobic amino acids, such as those observed in the putative hydrophobic transmembrane region, include leucine (L), valine (V), alanine (A), methionine (M) and phenylalanine (F).
Identify at least two limitations of Makennas model
Answer:Both legal and moral theorists have offered broadly “communicative” theories of criminal and moral responsibility.
Explanation:Mabey
During tubular secretion, fluid moves where:______.
Answer:
Renal tubular lumen
Explanation:
Tubular secretion is the process where fluid are moved are transfer from the peritubular capillaries to the renal tubular lumen of the kidney by the process of active transport and diffusion. It is the opposite of reabsorption and few substances are secreted in the nephron. Urine is left at reabsorption and secretion has taken place in the nephron.
10. What structure forms the boundary between the inside of the cell and the outside environment?
Answer:
Hmm.
Explanation:
The plasma membrane, the thin layer that forms the outer boundary of a living cell or of an internal cell compartment.