When students are given two texts on the same subject, one persuasive and one informative, what approach would be most helpful to determining purpose?A-the author's use of citations and verify that the sources are reliable.B-Summarize each paragraph in the margin and identify each paragraph's main idea.C-Determine whether each topic sentence is a claim or factual statement.D-Evaluate the author's use of figurative language.

Answers

Answer 1

When students are given two texts on the same subject, one persuasive and one informative,  the approach that would be most helpful to determining purpose will be to - (C) Determine whether each topic sentence is a claim or factual statement.

Any text that primarily aims to offer a vantage point and persuade a reader qualifies as a persuasive text. An argument, explanation, discussion, review, or even an advertising can all be considered persuasive texts. A persuasive text is a type of non-fiction literature that tries to persuade the audience of a particular viewpoint. Usually, the intent is to persuade the reader to make a purchase or take an action. Newspaper articles and advertisements make effective examples of persuasive writing. Nonfiction writing that is written with the goal of educating the audience about a certain subject is known as informative text. Books on science or history, journals, autobiographies, and instruction manuals are common places to find it.

To know more about  persuasive text:

https://brainly.com/question/22980149

#SPJ4


Related Questions

What lesson can we learn from Martin Luther King Jr?

Answers

Answer: A lesson that we can learn from Martin Luther King Jr is to never give up on your thoughts and dreams. Your opinions are important, and they truly matter. Besides, you should make constant efforts to evaluate and present your words before people.

Don’t give up on your ideas if people do not believe in them. Always remember that you need to stand up for yourself. You should stop expecting that people will stand up for you. Also, to never support a wrong action, no matter how tense the situation is. At the same time, always stand up for the right no matter how many are ignoring it. Be remembered as a supporter of truth rather than a concealer of the truth.

To know more about Martin Luther King Jr visit :

https://brainly.com/question/8560787?referrer=searchResults

What is the oldest punctuation?

Answers

The oldest punctuation mark is believed to be the interpunct, which dates back to ancient Greece. It was used to separate words and to indicate pauses in a sentence.


What is oldest punctuation?

The oldest known punctuation mark is the colon, which dates back to ancient Greece in the 4th century BC. The colon was used to separate a main clause from a subordinate clause, much like the modern semicolon. Other ancient punctuation marks included the period, the question mark, and the dash. These marks were used to indicate pauses, emphasize words and phrases, and mark the end of a sentence.

To learn more about oldest punctuation
https://brainly.com/question/92653
#SPJ4

1.01 Renaissance Poetry.

1. which of the following would NOT be considered a metaphysical question?

A. Can there be things that exist that are not in time?

B. is our gate predetermined?

C. Does God exist?

D. What is chemical composition of water?

2. What element does the metaphysical poetry of John Donne, George Herbert and Andrew Marvell have in common?

A. Romance
B. Wit
C. Tragedy
D. Perfect rhyme scheme

3. who is known as the founder and master of metaphysical poetry?

A. John Donne
B. George Herbert
C. Samuel Johnson
D. Andrew marvell

4. which of the following statements is UNTRUE of metaphysical poetry?
A. all of the metaphysical poets were friends who riffed off of each other's work.
B. it often compared unlikely things like lovers and a compass.
C. it dealt with questions that could not be explained by science.
D. metaphysical poetry aimed to shock the reader with its paradoxes and puns.

5. Metaphysical poetry:

A. is highly intellectualized
B. uses rather strange imagery
C. contains extremely complicated thoughts
D. all of the above are true

Answers

1. "What is chemical composition of water?" would not be considered a metaphysical question.

2. Wit is the common element  in the metaphysical poetry of John Donne, George Herbert and Andrew Marvell.

3. John Donne is known as the founder and master of metaphysical poetry.

4. The statement that is untrue of metaphysical poetry is all of the metaphysical poets were friends who riffed off of each other's work.

5. Metaphysical poetry is highly intellectualized, uses rather strange imagery and contains extremely complicated thoughts.

Learn more on metaphysical here:

brainly.com/question/11225181

#SPJ1

1. what is life compared to in the two metaphors?
2. suppose you do hold onto your dreams. using the same metaphors, how might langston hughes describe life then?

Answers

1. Life can be compared to a journey in two different metaphors. In one metaphor, life is like a journey on a road, where the individual is the traveler, and the path is the journey. In this metaphor, life is a journey with obstacles to overcome, destinations to reach, and lessons to learn along the way.

In the other metaphor, life is likened to a river, where the individual is the boat, and the current of the river is life. This metaphor suggests that life is an ever-changing, unpredictable journey that can take unexpected turns and have unexpected outcomes.

2. Langston Hughes might describe life as a journey where you hold onto your dreams like a traveler holds onto a map. The map is a symbol of hope and can help guide you in the right direction.

He might also describe life as a river, in which you can still move through it with courage and determination, even when the current is strong. He might emphasize the importance of resilience and perseverance, as these are essential in order to keep moving forward and make progress despite the ever-changing nature of life.

Learn more about metaphors:

https://brainly.com/question/10170227

#SPJ4

It is a good idea to prepare for possible layoffs by making sure ______. a. your cubicle is clean b. your boss likes you a lot c. your résumé is up to date d. your vacation is planned

Answers

It is a good idea to keep your resume current in order to be ready for any layoffs.

The labor market is changing quickly. While automation and technology have made it easier for firms to run, they have also occasionally led to positions being eliminated. Changes in the economy cause organizations to alter their staff. It should come as no surprise that many employees express fear over losing their employment.

It is also important to note that despite having less financial obligations, such as mortgages and children, people between the ages of 18 and 34 reported feeling more anxious about being laid off than older workers did. This might be because millennials remember what it was like to watch their parents lose their jobs during the Great Recession, or because younger workers are worried about their lack of experience.

To know more about layoffs click here,

https://brainly.com/question/15202950

#SPJ4

HELP PLS!!!!!!! Read the following sentence that a student wrote in an essay. How should the sentence be written correctly?

Bamboo is definitely one of the most interesting plants, it is valued for its beauty and usefulness.



Question 5 options:

correct as written


Bamboo is definitely one of the most interesting plants, it is valued for its beauty, and usefulness.


Bamboo is definitely, one of the most interesting plants, it is valued for its beauty and usefulness.


Bamboo is definitely one of the most interesting plants, and it is valued for its beauty and usefulness.

Answers

The option containing the correct version of the sentence is C, "Bamboo is definitely one of the most interesting plants, and it is valued for its beauty..."

What is the problem with the sentence?

The problem with the original sentence is simply a matter of punctuation. It consists of two independent clauses which are joined only by a comma, thus creating a run-on sentence. To correct it, we have the following options:

Separate the clauses with a period.Separate the clauses with a semicolon.Add a conjunction after the comma.

That is why option C is correct. It is the option that adds a conjunction after the comma. Since the other two options do not do any of the things mentioned above, we can discard them.

Learn more about punctuation here:

https://brainly.com/question/1224394

#SPJ1

ANSWER RIGHT AWAY PLS!!! What must happen at the end of any play?

At least one of its conflicts must be resolved.

At least two events must lead to a tragedy.

At least two scenes must occur in the same setting.

At least one of its characters must disappear.

Answers

Answer:

I think it's B because there is alot of things that can happen in a play and B is most likely to happen

There was a perpetual smile in his eyes, which seldom failed to awaken a corresponding cheerfulness in any one who looked into them and listened to his good-humored voice. His manner was quiet, and at times a little insolent. He possessed a good figure, a pleasing face, not overburdened with depth of thought or feeling; and his dress was that of the conventional man of fashion. Which statement best summarizes the explicit message in the excerpt?Edna's knowledge of the track is legitimate.
Edna is unsatisfied.
Arobin is a social man.

Answers

Arobin is a social man. A social man is one who is well-groomed, interacts with others, tells lighthearted jokes, and maintains a positive attitude at all times.

It is clear from the sentence above that Arobin possesses traits and demonstrates manners that will enable him to fit in with society. Kate Chopin's 1899 work The Awakening was published. The book's original title, A Solitary Soul, described a young mother's battle for personal and sexual freedom in the restrictive postbellum American South. Grand Isle, Louisiana's island is where The Awakening begins. The 28-year-old Edna Pontellier, her Creole husband Léonce, and their two kids, Etienne and Raoul, are on vacation.

To know more about The Awakening:

https://brainly.com/question/24240123

#SPJ4

What was the social contract 1973?

Answers

The Social Contract was a program of Harold Wilson's Labour government in Britain in the 1970s.

The Social Contract of 1973 is what?

The Social Contract was a program of Harold Wilson's Labour government in Britain in the 1970s. The Trade Union Congress agreed to support a voluntary wage restraint program in exchange for the repeal of the Industrial Relations Act of 1971, food subsidies, and a freeze on rent increases.

By permitting employers—who in nationalized industries became the state—to treat different groups differently in wage negotiations, the Social Contract attempted to circumvent the challenges of previous income policies.

To avoid repeated wage demands and give the state some level of predictability in future wage expenses, there would be a 12-month gap between wage settlements. Negotiated wage increases should be limited to making up for inflation since the previous settlement or for anticipated future price increases before the next settlement.

Learn more about the social contract with the help of the given link:

brainly.com/question/18024573

#SPJ4


From what did the rock that makes up the Hawaiian islands form? 

Answers

Answer: The Hawaiian Islands are built almost entirely of basaltic lava, the most abundant rock on Earth.

Please help!!!

which elements are most useful for creating a conversational writing style?

formal language and quotes

idioms and dialect

figurative language and facts

opinions and repetition

Answers

Figurative language and facts are the best instruments for creating a conversational writing style.

Figurative language deviates from the usual word order and meaning in order to convey a complex meaning, vivid writing, clarity, or an emotive comparison. It alludes to something without outright stating it by using a regular sentence.

A wide range of figurative languages are used in modern literature. They include:

In ordinary conversation, similes—figures of speech that use the terms "like" or "as," respectively—are frequently employed to compare two unrelated objects. A simile is employed to draw the reader's attention to an intriguing connection.

A metaphor is a comparison of two unconnected objects. The words "like" and "as," in contrast to similes, are absent from metaphors. Such observations may only be understood when the reader is aware of the connection between the two objects under comparison.

To know more about conversational writing click here,

https://brainly.com/question/28793978

#SPJ4

Hamlet knows Roseneraptz and Guildenstem were sent by the Queen and king to spy on him: However; he stillireveals true, information to them, such as his eloquent speech about his deep sadness with life and that he is only mad sometimes. Why do you think he chooses to show them some honestly even though he knows they are spies

Answers

Even though Hamlet is aware that they are spies because they were close friends when they were younger and he is assaulted by Hamlet's madness, Hamlet resolves to be honest about them.

When Hamlet comes, Polonius, Rosencrantz and Guildenstern see him first, and he immediately recognizes them as Claudius's spies. A troupe of traveling performers walks in as they are conversing. When Hamlet persuades one of them to give a speech, he realizes much to his shame that he has not been as fervent in seeking revenge for his father's death as the actor has been in acting. Hamlet tries to ascertain whether Claudius is accountable for the death of King Hamlet when the actors perform The Murder of Gonzaga for the court.

What is the most well-known passage from Hamlet?

Since that time, it has spread throughout the English language. A choice is whether to be or not to be. Said by Hamlet in the soliloquy for the nunnery scene. It's one of Shakespeare's most well-known quotations even today.

Why is Hamlet so distinctive?

Shakespeare does this through the soliloquy, a monologue in which a character speaks exclusively to himself on stage in order to examine his thoughts; Hamlet does this more than any other character. The intricacy of the mind is seen as a result. This is one of the reasons why people revere the drama.

To learn more about Shakespeare please click on the given link: https://brainly.com/question/18849112

#SPJ4

NEED HELP ASAP

In 'In the Lake of the Woods,' John reacts to circumstances and makes decisions that lead to his
eventual downfall. Could it be that the novel suggests, with such a bleak ending, that life is a matter of
dealing with circumstances that arise and taking responsibility for these decisions? Could it be that life
is about simply surviving the 'hand we are dealt?' John's overarching and ever-present desire to be
loved builds up from his childhood and leads him to deal with circumstances in peculiar ways. In what
ways does he later take responsibility for these decisions and how do they contribute to his
demise?

Answers

Answer:

Explanation:

John's lifelong struggle to be loved leads him to make decisions that ultimately contribute to his demise. He comes to believe in the power of love and forgiveness, believing that if he could just show his love, he could find redemption. This leads him to try to cover up the murder of his wife Kathy, believing that if he could hide the truth, he would be able to keep his family together and be loved.

However, John's attempts to cover up the truth eventually backfire, leading to his own downfall. He is unable to accept responsibility for his actions and instead tries to shift the blame onto others. He is unable to tell the truth about what happened to Kathy and instead tries to blame it on an unknown assailant. He also tries to blame his own psychological issues for his actions, believing that if he could just get help, he could be redeemed.

John's attempts to cover up the truth and shift the blame eventually lead to his own downfall. As the novel progresses, he is unable to live with the guilt of what he has done and eventually decides to take his own life. In this way, the novel suggests that life is a matter of dealing with circumstances that arise and taking responsibility for our decisions. It suggests that life is about simply surviving the 'hand we are dealt' and that if we are unable to accept responsibility for our actions, they will ultimately lead to our own downfall.

In "Tableau," the poet Countee Cullen describes an
unlikely pair of friends. How does the poet use specific stanzas and lines to focus
on the topic of friendship? Identify and explain the theme of this poem,

Answers

In "Tableau," the poet Countee Cullen uses the data on friendship and the way people love irrespective of color and gender.

What is the theme?

A theme is a key, overarching concept. As the characters work toward their objectives, the broader problem becomes apparent. It is more associated with the inner issues of identity, logic, or moral that emerge throughout their endeavors and fewer to do with if they'll succeed in winning the race, getting the date, or discovering the wealth.

The poet uses specific stanzas and lines

Locked arm in arm they cross the way,From lowered blinds the dark folk stare,Indignant that these two should dare

Learn more about the theme, Here:

brainly.com/question/11108997

#SPJ1

2. what more do we learn about the witches in i.iii? can they change the outcome of the future, or are they only able to forecast it? what evidence of this does the scene provide?

Answers

The three predictions of the witches in Macbeth are that Macbeth will become Thane of Cawdor, that Macbeth will become king thereafter, and that though Banquo never be king, his descendants will become kings.

Act 1, Scene 3 of the play, which takes place as Macbeth and Banquo are walking over the heath, contains the first three witches' prophecies. The three witches emerge out of nowhere and give Macbeth and Banquo seemingly encouraging prophesies. By referring to Macbeth as the Thane of Cawdor and future King of Scotland, the witches make two prophecies to him. The witches then speak to Banquo and tell him that even though he will never be king, his descendants will. Macbeth is simply the Thane of Glamis at the present, and he wonders how he would rise to become the Thane of Cawdor and the future king. Soon after the witches vanish, King Duncan's emissaries show up and confirm one of the witches' forecasts by telling Macbeth that he has been given the title Thane of Cawdor.

On the heath, Macbeth and Banquo run into the witches. When Banquo inquires about his future, the witches tell him that Banquo's descendants will rule as kings. They also foretell that Macbeth would be appointed Thane of Cawdor and subsequently King of Scotland. Astonished by the forecasts, Macbeth Witches vanish, and the King's messenger informs Macbeth that he is the new Thane of Cawdor. Banquo alerts Macbeth of the danger, leaving him speechless. Macbeth tries to conceal his preoccupation with becoming king.

To learn more about Macbeth Please click on the given link:

https://brainly.com/question/1720128

#SPJ4

Women’s style of communication has often involved ____________. a. telling others what to do b. thinking only about themselves c. understanding others’ emotions d. trying not to get involved with others

Answers

Women’s style of communication has often involved understanding others’ emotions.

Hence, Option C is correct.

Speaking, writing, listening, and reading are all forms of communication.Clear speakers and writers who respect different points of view are good communicators. Passive, aggressive, passive-aggressive, and assertive are the four fundamental communication styles. It's critical to comprehend each communication method and the reasons behind its use.By enabling us to connect with others and share our needs and experiences, communication supports relationship-building in daily life. The ability to communicate our thoughts, share information, and express our emotions is at the core of life.emotional responsesFeelingsEmotional statesThoughts and feelingsEmotional reactionsFeelings and thoughtsEmotional experiences

To know more about communication here

https://brainly.com/question/26152499

#SPJ4

What do birds singing symbolize?

Answers

Birds singing can symbolize many different things. It can represent joy and happiness, freedom, or even a sign of good luck.

What do you mean by happiness?

Happiness is a feeling of contentment, satisfaction, and joy. It is a state of mind that comes from within, rather than from external factors. Happiness is a positive emotion that can be experienced in different ways by different people. It can be a result of achieving goals, overcoming obstacles, or simply finding contentment in everyday life.

To some people, birds singing can represent a sense of peace and tranquility. In many cultures, birds singing is seen as a sign of good luck or a message from the gods. To others, birds singing may symbolize a new beginning or change.

To know more about happiness,

https://brainly.com/question/16502946

#SPJ4

What are the three types of poetry The Japanese brought?

Answers

Japanese poetic styles. The three main types of Japanese poetry since the middle of the 19th century have been tanka (the current name for waka), haiku, and shi or western-style poetry.

What are the three categories of poetry?

The three basic categories of poetry are lyrical, dramatic, and narrative. Making a distinction between them isn't always achievable. For instance, a lyrical poem may have narrative sections, as may an epic poem.

What genre of poetry is Japanese?

Haiku: The most well-known type of Japanese poetry is the haiku. A different type of poetry known as renga once used the haiku as the first stanza.

To know more about Japanese poetic styles visit :-

https://brainly.com/question/30122664

#SPJ4

Which sentence uses the
underlined academic
vocabulary word incorrectly?
A. There is a proven link between "caring"
and "thriving" in human beings.
B. There is a link between having a family
and living a longer life.
C. She is definitely an intrinsic due to the
fact that she is never on time.
D. The scientist had an intrinsic sense for
just what experiments to run each time.

Answers

Answer: The sentence "She is definitely an intrinsic due to the fact that she is never on time" uses the underlined academic vocabulary word "intrinsic" incorrectly.

Intrinsic means innate, inherent or internal and it is not used to describe a person's behaviour or characteristic.

It should be replaced with another word that better describes the intended meaning.

pls help i need a fictin story essay done at 4:00

Answers

Answer:

full answer in below

Explanation:

Once upon a time, in a land far, far away, there lived a young prince named Alex. He was the only son of the King and Queen, and was adored by all of the people in his kingdom.

One day, while out on a hunting trip, Alex stumbled upon a mysterious, hidden cave deep in the forest. Being the curious and adventurous prince that he was, he decided to explore the cave. As he ventured deeper and deeper into the cave, he came across a beautiful, magical crystal.

Without hesitation, Alex picked up the crystal and held it in his hands. Suddenly, he was enveloped in a bright light and felt a strange energy flow through his body. When the light dissipated, Alex found that he had been gifted with magical powers.

Excited by his newfound abilities, Alex returned to the kingdom and decided to use his powers for the betterment of his people. He used his powers to heal the sick, grow bountiful crops, and bring peace to the land.

But with great power comes great responsibility, and soon, an evil sorcerer emerged and challenged Alex's rule. The sorcerer, who was jealous of Alex's powers, wanted to take over the kingdom and use the magic crystal for his own nefarious purposes.

Alex knew that he had to stop the sorcerer, and so he set out on a journey to defeat him. He gathered a group of brave warriors and set out to defeat the sorcerer and his army of dark creatures.

The final battle between Alex and the sorcerer was fierce and intense, but in the end, Alex emerged victorious. He defeated the sorcerer and reclaimed the kingdom, saving his people from certain doom.

From that day on, Alex was known as the "Magical Prince" and was loved and revered by all of the people in the kingdom. He ruled justly and with compassion, and his kingdom flourished for many years to come.

The end.

Which sentence from the passage is an adage?
Responses
A You can eat them all
B All’s well that ends well
C Like you have nice things anyway
D Sounds waffle

Answers

The Answer is B.

Adage definition: a proverb or short statement expressing a general truth.

Examples: “Opposites attract”, “Better safe than sorry”, “The early bird gets the worm”.

1.
In your notebook, make a table, and write in it the subject, verb and object of the sentenc
below. You may leave out words that do not form part of the subject or the object.
Example: A cat has entered the room.
a.
Subject
A cat
Verb
has entered
The packers packed all the boxes.
C.
I pulled a couple of toys from the box.
e. We entered the playroom.
b.
d.
He carried the box into the playroom. h.
Object
the room.
My sister blamed me for their moodiness.
I felt the breeze again.
f. Mother explained what had happened.
Someone had used the doorway quite re-
Find the verb and the object in the following sentences.
a. Matilda scolded her brother.
b. The woman wanted medicine.

Answers

The verb in the following sentences are scolded and wanted, and objects are brother and medicine.

What is verb?

A verb is a term that denotes a mental or physical activity, such as "think" or "drive," or a state of being, such as "exist." A verb is present in every phrase. When a noun or pronoun is used to describe what the noun or pronoun is doing, verbs are nearly usually employed as well.

A polymorphic and inheritable abstract data type is what makes up an object. Therefore, The verbs scolded and wanted are used in the phrases below, and the objects are my brother and medicine.

Learn more about verb here;

https://brainly.com/question/14574299

#SPJ1

From a prior scene, the audience knew that the lead was hysterical because of the contemptible villain. Suffixes help a reader understand the meanings of words. Which words in the sentence have suffixes

Answers

In the sentence, "From a prior scene, the audience knew that the lead was hysterical because of the contemptible villain." the suffix is hysterical.

A suffix is an addition that is essentially glued onto a word; you start with the fundamental form of the word (for instance, play), and then you add the suffix at the end (-ing), and you obtain a new term (playing).

Given this, the words hysterical (derived from hysteric + suffix -al) and contemptible (derived from contempt + suffix -ible) are both acceptable choices.

From the above explanation the correct answer is Hysterical.

The given question is incomplete, the complete question is:

Read the sentence.

From a prior scene, the audience knew that the lead was hysterical because of the contemptible villain.

Suffixes help a reader understand the meanings of words. Which words in the sentence have suffixes? Check all that apply.

prior

audience

hysterical

contemptible

villain

To learn more about suffix here:

brainly.com/question/12938984

#SPJ4

n 150 words, write a paragraph in which you use a pathos-based argument to explain why a city-wide curfew for teenagers should or should not be instituted in your town.


Answers

A city-wide lockdown shouldn't be implemented because it restricts teenagers' nighttime activity and participation in outside world. Many youths would irritated by curfew but they would unable to ride their bikes.

What exactly is a paragraph?

A paragraph is a collection of sentences that elaborate on a single idea. To be effective, a paragraph must initiate with a main point, contain sentences that sustain the principal idea of the paragraph, and keep a flow. informs and amuse your audience about your publication's overall idea.

What exactly is a paragraph and what is an example?

A paragraph is a group of sentences that are all related to the same topic and are organized and coherent.

To know more about paragraph visit:

https://brainly.com/question/24460908

#SPJ1

Lousie ……………………………. Told her dad she was going to the park, so he wasn’t surprised when she went.

Answers

Louise's father wasn't surprised when she went to the park because she had told him she was going there.

Had is used where?

The past tense or past participle of the verb have1 is had. Sometimes, instead of starting a word with "if," the word "had" is used to refer to an event that might have occurred but did not. For instance, "had she been elected" has the same meaning as "if she had been elected."

had been used in a sentence?

Here is an illustration of how the word "has had" uses in a sentence: David had a lovely vehicle. This sentence may be referring to a previous event depending on the particular situation. David has, thus, owned a nice automobile (in the past).

To know more about had visit:

https://brainly.com/question/74246

#SPJ1

questionread the passage.after serving the community for 30 years, kids first academy (forest glen campus) will close this friday. the owners of the preschool cited low enrollment and increasing building costs as reasons for their decision. this school year 63 students were enrolled, compared with 75 students the previous school year.which language feature does this passage contain?responsescolloquialismcolloquialism,personal experiencepersonal experience,precise wordsprecise words,imagery

Answers

Option c: precise words. The language feature is that this passage contains precise words.

Precise words are short alternative words for long sentences. They are clear, understandable and constructive language. For example, the correct word for "majority" is "most".

Precise words convey a similar meaning to longer sentences but are clearer. Skilled writers know that using certain and precise words influences their audience.

Everything is very clear in this excerpt, as no vague words are used. However, there are also no images associated with creating vivid images.

The excerpts are truly objective and reflect only facts, no personal experience. No colloquial language.

To learn more about 'Precise words', here:

https://brainly.com/question/3540264

#SPJ4

what is a codon and what is its role in protein synthesis?

Answers

A codon is a segment of DNA or RNA that consists of three nucleotides (a trinucleotide) and encodes an individual amino acid or indicates the end of protein production (stop signals).  There are 64 distinct codons, 61 of which designate amino acids, and 3 of which serve as stop signals.

In eukaryotic cells, what function do codons play in the production of proteins?

A particular amino acid is coded for by sets of three nucleotides known as codons. Each codon is read by the ribosome one at a time as tRNA attempts to match the codon's anticodon to the anticodon of the tRNA.

What are the final three codons in the synthesis of proteins?

The stop codons, UAA, UAG, and UGA, are used to indicate when translation has finished.

To Know more about individual

https://brainly.com/question/19537863

#SPJ4

write an argumentative essay on teacher is better than a doctor not more less than 450 words​

Answers

Answer:

see below

Explanation:

Good day most honorable chairman, respected judges, accurate time keeper, co-debaters and my august audience. My name is [your name] and I stand before this honorable and reputable assembly to confidently support an indisputable and irrefutable fact which state: “teachers are more important than doctors”. Before I proceed, I’d like to define to your hearing the meaning of doctor and teacher, first a teacher is a trained fellow in a particular field in order to impact knowledge, skills, morale, virtues and value unto anyone that is to learn something, he/she sees impacting knowledge as pertinent and he shun against ignorance at all cost, although, it suffice to say that there are of course bad teacher and also good once are as many. On the other is the doctor who is medically trained to diagnose illness and proffer panacea or medical remedies to various form of health problem, he studies for number of year in higher institution ranging from 8 years and above as the case may be in various country.

Firstly, the teaching gives the real sense to many types of people in the society be it accountant, medical doctor, philosophers, journalist, newscaster and a lot of professional works, medical doctors derives all that valuable sense of their from the canopy of the teacher’s. No any doctor will cure a problem if there is no intervention of learning and adequate skill to do so. With no teacher to teach the doctor, many of them will be refer to as “quacks” which means that a doctor giving ineffective and inefficient services, many people that will be going to those for help, will become victims of circumstances and many lives has been lost from this most wicked practitioners.

Secondly and equally important is that without teachers, there will be high Level of illiteracy, the teacher tends to be one of the country dignity lifter through saving individuals from the shackles of ignorance, a state with inadequate teachers suffers this problem, gone are does days when most African country are illiterate, but as time goes on the system of teaching was brought to them by the likes of British, Portugal, France and many other, this has been a system of inculcating concept into human being and it is only done by the teacher, how will countries be without the restlessness, selflessness, patriotic, altruism and the humanitarian efforts of the teacher? A country with the help of teacher is always seen in the international.

consider the following two sentences: sentence 1: although dogs are popularly known as 'man's best friend,' cats are actually the most popular pet in the united states. sentence 2: cats are stereotyped as standoffish and mysterious, while dogs are more commonly seen as enthusiastic and loyal, living up to their nickname as 'man's best friend.' what is the relationship between sentences 1 and 2?

Answers

The two sentences are neither summaries or repetitions of one another.

The act of utilizing a word or phrase repeatedly is known as repetition. In writing and speaking, it is a common rhetorical device for emphasizing ideas. Repetition is a common literary device that appears in both poetry and prose, in all literary genres and forms, as well as in oral tradition. Authors and presenters can use repetition as a potent strategy to develop their style, tone, and rhythm in addition to highlighting or reinforcing important ideas and concepts.

An executive summary is a succinct statement that informs the reader of the key points of a lengthy piece of writing. The summary is essentially a condensed version of a lengthy material.

To know more about sentences click here,

https://brainly.com/question/552895

#SPJ4

What are 3 examples from these chapters that would that girls had to be strong individuals during the time the novel took place in order to survive from lyddie in chapters 10-12

Answers

Middle of the nineteenth century is when Lyddie is set. The industrial revolution is well underway, and women of those times must be exceedingly resilient.

What was Lyddie's major point?

The story of independence is found in Katherine Paterson's book Lyddie. Lyddie is unrestricted and even with her family at the farm. Her father's departure, her family's debts, and her many employers all pose immediate threats to her freedom.

How did Charles and Lyddie survive the winter?

After returning from assisting his mother, Agnes, and Rachel in making it safely to Poultney, Charlie and Lyddie were able to endure the chilly winter in their cabin. To make sure they would live, the pair of them hunted rabbits and scraped bark for soup.

To know more about Lyddie, visit:
https://brainly.com/question/23246399

#SPJ1

Other Questions
30 POINTS ASAP America at the Turn of the Centuryadapted from the Library of Congress By 1900 the American nation had established itself as a world power. The West was won. The frontier was no more. The continent was settled from coast to coast. Apache war chief Geronimo had surrendered in 1886. Defeat of the Sioux at the battle of Wounded Knee in 1891 had brought the Indian Wars to a close. By 1900 American Indians were on reservations and the buffalo were gone. Homesteading and the introduction of barbed wire in 1874 had brought an end to the open range. The McCormick reaper had made large-scale farming profitable. In 1900, the U.S. was by far the world's largest agricultural producer. The first transcontinental rail link had been completed in 1869. Three decades later, in 1900, the nation had 193,000 miles of track, with five railroad systems spanning the continent. The world's first oil well had been drilled in Titusville, Pennsylvania, in 1859. By 1900, major oil fields were being tapped in Kansas, Illinois, Louisiana, Oklahoma, and Texas. The supply of American oil seemed limitless. John D. Rockefeller's Standard Oil Trust dominated the world's petroleum markets. It controlled more than 90 percent of the nation's refinery capacity. At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced. In the 1880s Andrew Carnegie had constructed the world's largest steel mill in Pittsburgh, Pennsylvania. By 1900, the United States was the largest steel producer in the world, turning out 10,000,000 tons a year. Henry Ford had built his first gasoline engine car in 1892 and the world's first auto race was held in Chicago in 1896. With the founding of the Ford Motor Company in 1903, the age of the automobile was underway. By 1900, telephones were in wide use. Cities were being electrified. Moving pictures were a curiosity. Guglielmo Marconi was conducting experiments that would lead to the development of the radio, and the Wright brothers were at work on a heavier-than-air flying machine. Cities were growing. New wealth and devastating fires produced a boom in urban construction. Architects Richardson, Hunt, McKim, Mead, and White flourished. Sullivan pioneered the skyscraper and his protg, Frank Lloyd Wright, was beginning his career in Chicago. This was a time of both confidence and ferment. In the cities and the states, political "Progressives" were coming to power, experimenting with reforms such as women's suffrage, direct election of United States senators, the initiative, recall, the Australian ballot, primary elections, and laws setting minimum wages, work standards, and regulated rates for common carriers and services. Followers of the Progressive movement believed in the perfectibility of man and his society. Republican William McKinley of Ohio was elected president in 1896 and re-elected in 1900. He had been preceded by Democrat Grover Cleveland. McKinley looked every inch a president. Young reporter William Allen White said of him after an interview: "He was the statue in the park speaking." A dignified, reserved man, McKinley was the last of the old-style, low-key presidents. McKinley was the last of five Civil War veterans to serve in the White House, signaling the end of the post-war era. He was also the fifth of the six Ohio presidents to serve during the fifty-year period 1868-1908. McKinley is generally considered to have been a good but weak man. He would be followedand overshadowedby Theodore ("Teddy") Roosevelt, who was vice-president when McKinley was assassinated in 1901. Later, Roosevelt would be elected president in his own right. The ascendancy of Ohio and the Midwest in national politics demonstrated that the United States was no longer a nation oriented to the Atlantic seaboard. It stretched, as the anthem, America the Beautiful, put it, "from sea to shining sea."Select all the correct answers.Read the sentence from "America at the Turn of the Century."At the turn of the century, the strength of a nation's industry was measured by the number of tons of steel it produced.Which three sentences correctly paraphrase the sentence?A. A nation's industry was considered powerful by the number of tons of steel it produced (Library of Congress). B. In the late 19th century, it was the amount of steel produced that showed how powerful a nation's industry was (Library of Congress). C. A nation's industry was considered powerful only if it managed to produce a large quantity of steel (Library of Congress). D. At the turn of the century, the number of tons of steel helped determine the strength of a nation (Library of Congress). E. The quantity of steel produced helped determine the strength of a national industry (Library of Congress). which would the nurse plan to offer the parents of a child who was treated for acute glomerulonephritis in preparation for the discharge? ache mothers, in paraquay, carry their young children almost all the time to protect them from getting hurt in the forest. consequently, their children walk almost a year later than american children. based on this example, do you think it is the impact of nature, nurture, both or neither that influenced this cultural difference? You develop and deploy several microservices to an Azure Kubernetes Service (AKS) cluster. The microservices are instrumented with the Application Insights SDK. You configure an Application Insights instance and use the connection string in the instrumentation.The instrumentation includes a custom telemetry value used to track the order checkout action. Order checkout is an action that includes a property to capture the order number.You need to capture the custom order telemetry.Which Application Insights data type should you use?Select only one answer.tracedependencymetricevent Otis wants to borrow 10000 to buy a used car. he examined his budget and decided that he can afford a payment of $200 a month. if his bank offers him a rate of 7.5%, how long should he borrow the money so he can afford his monthly payment? two harmonic waves are described by y1= (4m) sin (8/mx-300/s t) y2=(4m) sin (8/mx-300/s t-2) what is the wavelength of the resultant wave ? Below you will find the yearly average values of the Dow Jones Industrial Average, the most popular index of stock market prices, for five different years. The Consumer Price Index for each year (on a base of 1982- 1984 = 100) can be found on the inside back cover of this book. Use these numbers to deflate all five stock market values. Do real stock prices always rise every decade?Year Dow Jomes Industrial Average1970 7531980 8911990 2,8792000 10,7352010 10,663 DXL Practice with algebrai XDL | Identify equivalent in X Q Algebra It A Common Cor X DAt the start of the softball x GIdentify equivalent linear Xbd.com/math/grade-7/identify-equivalent-linear-expressions-word-problems?signinRedirect=https%3A%2F%2Fwww.ixl.com%2Fsignin%2 R.23 Identify equivalent linear expressions: word problems KWH>120xx + 1.2xSubmitAlec's parents give him x dollars per month for his allowance. However, since his birthday isin February, he gets an extra 20% bonus that month.Pick all the expressions that represent how much Alec's allowance is in February.x + 0.2x+1.2x*DX Consider the deflection (based on choices of E and I) and the weight of the material. How would you find a balance between the needed structural performance and weight? what decreases the possibility that errors will be caught and the potential for fraud will be increased? The measure of angle JKL is 145.The measure of angle MKL is 60.The measure of angle JKM is x.Find the value of x.X=0X5XK145M60D the dominican republic has 10.7 million people and a national population growth rate of 1.5 percent. paraguay has 6.8 million people and a national population growth rate of 1.5 percent. in how many years will each country double in size? sean is one of several general partners who own pints and cans, a small chain of bar and grills located in illinois and indiana. sean is interested in converting the partnership into a master limited partnership. if he convinces other partners to go along with his idea, pints and cans will select one: a. offer shares of ownership that are traded on a stock exchange much like a corporation. b. pay its taxes like a corporation. c. begin to operate much like a sole proprietorship. d. have to change its name to include the term ltd. in its title to indicate its owners have limited liability. this tissue type can perform absorption or secretion in the body. Culture is taught formally and informally. Identify the following sources as providing either formal or informal instruction. Did the Filipinos benefit from the political changes that the Spaniards introduced? URGENT- ENGLISH 12 FINAL CONNEXUS PLEASE HELP Jordan has 8 coins in his pocket. They are a combination of dimes and quarters. If they total to $1.25, how many of each coin does he have an equilateral triangle has a side measure of 10 in. what is the measure of each of the angles of the triangle? question 1 options: 10 degrees 60 degrees 30 degrees 18 degrees Russia 1996/4) In the Duma there are 1600 delegates, who have formed 16000 committees of 80 persons each. Prove that one can find two committees having at least four common members.