Answer:
B. Photosynthetic
Explanation:
Kingdom animalia and protista are two of the seven classification of kingdoms. Kingdom Animalia is characterized by their eukaryotic multicellular cell and heterotrophic nature of nutrition i.e. depend on other organisms for energy source.
Kingdom protista, on the other hand, are grouped because they do not fit into any other kingdom. Protists can be autotrophic or heterotrophic, single celled or multicellular. Some protists are capable of autotrophic nutrition via photosynthesis e.g algae.
This photosynthetic process is the difference between the protists and animals. Animals can never be autotrophic.
The following characteristics is not shared between Kingdom Protista and Kingdom Animalia is option B. Photosynthetic
Kingdom Protista & Animalia:Kingdom Animalia and Protista should be two of the seven classifications of kingdoms. Kingdom Animalia should be characterized by their eukaryotic multicellular cell And heterotrophic nature of nutrition based on other organisms for an energy source.
learn more about Photosynthetic here: https://brainly.com/question/15538432
1. Which of the following is a micronutrient?
your answer is
I hope it will helpful for you
please mark as brainest answer
thank you
A scientist is conducting research to see whether dogs or cats are more popular. He goes to a dog park and asks all of the owners which pet they prefer. 100% of those polled stated that dogs are their favorite animal.
This experiment is an example of:
A) personal bias
B) experimental bias <<<<
C) cultural bias<<<<
D) a controlled experiment
PLEASE CHECK
Answer:
It is a controlled experiment. (D)
Explanation:
The reason why is because a scientist went to a dog park to conduct the experiment, there would be no cat owners there so obviously everyone would choose dogs because that is their pet. The scientist ran a controlled experiment.
I need help filling in the blank boxes and any other box i got wrong
What is the volume of the rectangular prism?
Answer:
270cm³
Explanation:
Volume of the rectangular prism: length * width * height.
In this case: 6cm * 9cm * 5cm
What criteria is used to divide the
earth into layers?
A. Each layer is 10 miles thick.
B. Each layer is 100 miles thick.
C. The age of the rock is determined.
D. It is based on physical and chemical properties.
Organisms that belong to the same class must belong to the same:
Answer
The taxonomical classification of organisms follows this list of categories
Kingdom
Phylum
Class
Order
Family
Genus
Species
The number of organisms decrease from the top(Kingdom)to the bottom(Species).
Order Phylum is the answer
Oxygen was added to early earth’s atmosphere through
Answer:
Hey There!!
You can say that...
Oxygen was added to early earth’s atmosphere through PHOTOSYNTHESIS!
Explanation:
The introduction of organisms which respired with the Sunlight and CO2 through PHOTOSYNTHESIS had brought a change in the Earth's early atmosphere...
PHOTOSYNTHESIS produces OXYGEN as a waste product (it's not needed by the organism)
This Oxygen is then released into the atmosphere where it was either converted into OZONE or left to move around the rest of he atmosphere...
I HOPE THIS HELPS WITH YOUR WORK!
:D
How might you go about explaining the problem of climate change to friends and family? How could you encourage them to take climate action?
Answer:
Can you explain to them why it is not a hoax, because some people believe it is.
What are the adaptations of a wind pollinated flower?
The main adaptations of wind-pollinated plants are: The flowers are small inconspicuous, lacks fragrance and nectar. They are not attractive colors. The perianth lobes are reduced. The pollen grains are smooth, light, and dry. Usually bears unisexual flowers.
During tubular secretion, fluid moves where:______.
Answer:
Renal tubular lumen
Explanation:
Tubular secretion is the process where fluid are moved are transfer from the peritubular capillaries to the renal tubular lumen of the kidney by the process of active transport and diffusion. It is the opposite of reabsorption and few substances are secreted in the nephron. Urine is left at reabsorption and secretion has taken place in the nephron.
what is the name of a process that produces use to make their own food
Answer:
Photosynthesis
Explanation:
Photosynthesis. Plants are autotrophs, which means they produce their own food
I hope this helps.
In the equation, C6H12O6 is a
Answer:
Glucose
Explanation:
Which of these is the same form of energy as light? Select the correct answer.
O A. Radio waves
OB. Sound waves
O C. Electricity
OD. Potential energy
The apple maggot is a pest of hawthorn plants and apple trees. Before the introduction of apple trees 200 years ago, apple maggot flies laid their eggs only on hawthorns. After the introduction of apple trees, these flies started to lay eggs in apples or hawthorns. These flies tend to live and reproduce in the type of plants they were born in. Therefore, hawthorn flies tend to mate with other hawthorn flies and apple flies tend to mate with other apple flies. Some genetic differences are currently found between these two groups of flies. If these flies become different species in the future, this will be an example of what
Answer:
It is an example of the evolution of species, the adaptation of the fittest as mentioned by Charles Darwin when analyzing the Galapagos Island.
Explanation:
We call this process where the fittest evolve and the least adaptive die out, we call natural selection.
types of microorganism and examples of them
Answer:
bacteria- salmonella, E. Coli
archaea- Acidilobus saccharovorans, Aeropyrum pernix
fungi- Mushrooms, yeast, and molds
protozoa- flagellate Trypanosoma
algae-green algae and brown algae
viruses- smallpox, flu
Why does atomic radius increase as you travel from top to bottom within a family?
A. number of energy levels/ shells increases
B.atomic mass decreases
C.number of valence electrons increases
D. atomic number decreases
Which of the following experimental treatments would NOT be a potentially effective strategy to inhibit or prevent cell-cell adhesion? Which of the following experimental treatments would NOT be a potentially effective strategy to inhibit or prevent cell-cell adhesion? removal of calcium ions from the extracellular space application of a protease that specifically destroys CAMs application of an antibody that inhibits the function of lectins adding an antagonist to prevent integrin function
Answer:
adding an antagonist to prevent integrin function
Explanation:
An antagonist is a drug capable of binding to a specific receptor, thus blocking the binding of endogenous ligand molecules. According to their mode of functioning, the antagonists are classified into four classes: chemical, physiological, competitive and non-competitive. Integrins are specific transmembrane receptors that facilitate cell adhesion. In consequence, in the case above indicated, the use of an antagonist for the integrin receptor will prevent cell adhesion.
What’s wrong with this statement?
Barbie and ken accidentally break a beaker full of some chemical. Instead of risking getting in trouble they quickly clean up the mess with paper towel and throw it in the garbage.
Answer:
Barbie and Ken accidentally BROKE a beaker full of some CHEMICALS. Instead of risking getting in trouble they quickly CLEANED up the mess with paper TOWELS and THREW it in the garbage.
The scientist eventually observes the cells undergo a sudden and radical shift in their structure/shape and their motility (ability to move). He asks himself questions about what is causing this shift in behaviors and begins to design an experiment to determine the answer. Briefly describe how the scientist practiced both the exploration and testing aspects of scientific inquiry
Answer:
The scientist raises a question about cellular phenomena that is tested by a hypothesis-led procedure, and the resulting information may then be used to find the reasons for his observations
Explanation:
The scientific method is a rigorous process that involves a series of steps: 1-to make observations about the real world, 2-to ask a question related to these specific observations, 3-to raise a working hypothesis, 4- to test the hypothesis, 5-to analyze the results and 6-to obtain conclusions (i.e., reject or confirm the hypothesis). In the scientific method, a scientific question must be measurable, defined and testable. Moreover, the scientific hypothesis must be a well-defined and coherent conjecture which is tested by experimental or observational procedures in order to seek answers to the scientific question.
List 4 different ways microorganisms affect our daily lives.
Fossil fuels are formed when organic materials decompose and sendiments are deposited on top of them.This process of sediments accumulation over time leads to________of the sediments.
Oil
Explanation:
The process of sediment accumulation over time leads to Oil
The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces)
Answer:
LVAAMQLLLLLFLLLFFLV
Explanation:
Transmembrane domains are hydrophobic regions inserted into the cell membrane, while surrounding protein regions are often designed to localize on opposite sides of the membrane. In general, hydrophobic amino acids are inserted into the hydrophobic core of the membrane. These hydrophobic residues have side-chains which are insoluble in water. Examples of hydrophobic amino acids, such as those observed in the putative hydrophobic transmembrane region, include leucine (L), valine (V), alanine (A), methionine (M) and phenylalanine (F).
1. Which model best illustrates the formation of blood cells? A- dissected pig B- plastic bone C- photograph of a bone D- computer-generated model
Answer:
D- computer-generated model
Explanation:
Computer models are widely used to show real-life situations. Many biological, physical, chemical and engineering processes are easily simulated using a powerful computer system.
Therefore, the formation of blood cells can also be adequately simulated using a powerful computer system, hence the answer above.
Answer:
It's D
Explanation:
Psychology is considered as what
type of science?
A. Medical
B. Historical
C. Social
Answer:
social
Explanation:
hope this helps!
Who is the hottest girl in the world
Answer:
most definitely not you
Explanation:
everyone is equally beautiful.
How do limiting factor determine the carrying capacity of an ecosystem
Answer:
Ecosystems only have so much food, water, space, and other resources. When different types of organisms all live in these areas, theres only so much that can go around.If an ecosystem has more organisms than its water supply can support then it is beyond its carrying capacity. The ecosystem will not be able to support the organisms and they will have to either relocate or die until the ecosystem is once again at or below carrying capacity.
The carrying capacity of an ecosystem is directly proportional to the limiting factors. Limiting factors increase, carrying capacity of an ecosystem increases.
What is Carrying capacity?Carrying capacity may be defined as the maximum number of an individual that can be supported by a habitat. The carrying capacity of any habitat depends on the following two factors:
The food to eat.The space to live.When limiting factors such as food, space, water, nutrients, etc. in a habitat increase, the carrying capacity of the habitat will definitely increase. This situation remains the same until there will be a scarcity in all those limiting factors suffered by a habitat.
When the limiting factors decline, the carrying capacity of the habitat ultimately lowers.
Therefore, it is well described above.
To learn more about Carrying capacity, refer to the link:
https://brainly.com/question/26660965
#SPJ6
Which material undergoes radioactive decay?
A material undergoes radioactive decay if it has an atom with unequal number of protons and neutrons.
What is an atom?
An atom is defined as the smallest unit of matter which forms an element. Every form of matter whether solid,liquid , gas consists of atoms . Each atom has a nucleus which is composed of protons and neutrons and shells in which the electrons revolve.
The protons are positively charged and neutrons are neutral and hence the nucleus is positively charged. The electrons which revolve around the nucleus are negatively charged and hence the atom as a whole is neutral and stable due to presence of oppositely charged particles.
Atoms of the same element are similar as they have number of sub- atomic particles which on combination do not alter the chemical properties of the substances.
Learn more about atom,here:
https://brainly.com/question/13654549
#SPJ2
Which is located inside the lung?
O the larynx
O the pharynx
O the trachea
O the alveoli
1 answer choice
Answer:
d is the answer
Explanation:
there you go have a good day
Within the lung are the alveoli. The larynx, sometimes known as the voice box, contains your vocal chords. The inhaling & exhalation of air supplied results in voice sounds.
What are the lungs used for?Respiration, a process of gas exchange, is the major purpose of the lungs (or breathing). In the process of respiration, dioxide, a waste material of metabolism, exits the blood and oxygen from the incoming air enters. Decreased lung function refers to the lungs' diminished mental capacity to transfer gases.
Do your lungs ever ache?Since the lungs lack pain receptors, it's not the lungs itself that hurt when someone suffers painful respiration. But illnesses that impact the heart, kidneys, joints, and muscles
To learn more about: Lungs
Ref: https://brainly.com/question/19135226
#SPJ2
Identify at least two limitations of Makennas model
Answer:Both legal and moral theorists have offered broadly “communicative” theories of criminal and moral responsibility.
Explanation:Mabey
What is the value of 6.74×106 when written in decimal form?
Answer:
714.44
Explanation:
First do 674x106 which is 71444. Then add in your decimal point which has two numbers after it so add it in the same spot from the right.
Answer:
0.063584906
Explanation:
Divide 6.74/ by 106= 0.063584906
