Answer:
no ideal
Explanation:
please let me know the answer
What’s wrong with this statement?
Barbie and ken accidentally break a beaker full of some chemical. Instead of risking getting in trouble they quickly clean up the mess with paper towel and throw it in the garbage.
Answer:
Barbie and Ken accidentally BROKE a beaker full of some CHEMICALS. Instead of risking getting in trouble they quickly CLEANED up the mess with paper TOWELS and THREW it in the garbage.
Which of the following types of models is most likely to be used to predict earthquakes?
Answer:
computer model
Explanation:
A scientist is conducting research to see whether dogs or cats are more popular. He goes to a dog park and asks all of the owners which pet they prefer. 100% of those polled stated that dogs are their favorite animal.
This experiment is an example of:
A) personal bias
B) experimental bias <<<<
C) cultural bias<<<<
D) a controlled experiment
PLEASE CHECK
Answer:
It is a controlled experiment. (D)
Explanation:
The reason why is because a scientist went to a dog park to conduct the experiment, there would be no cat owners there so obviously everyone would choose dogs because that is their pet. The scientist ran a controlled experiment.
The scientist eventually observes the cells undergo a sudden and radical shift in their structure/shape and their motility (ability to move). He asks himself questions about what is causing this shift in behaviors and begins to design an experiment to determine the answer. Briefly describe how the scientist practiced both the exploration and testing aspects of scientific inquiry
Answer:
The scientist raises a question about cellular phenomena that is tested by a hypothesis-led procedure, and the resulting information may then be used to find the reasons for his observations
Explanation:
The scientific method is a rigorous process that involves a series of steps: 1-to make observations about the real world, 2-to ask a question related to these specific observations, 3-to raise a working hypothesis, 4- to test the hypothesis, 5-to analyze the results and 6-to obtain conclusions (i.e., reject or confirm the hypothesis). In the scientific method, a scientific question must be measurable, defined and testable. Moreover, the scientific hypothesis must be a well-defined and coherent conjecture which is tested by experimental or observational procedures in order to seek answers to the scientific question.
Which of these is the same form of energy as light? Select the correct answer.
O A. Radio waves
OB. Sound waves
O C. Electricity
OD. Potential energy
Why does atomic radius increase as you travel from top to bottom within a family?
A. number of energy levels/ shells increases
B.atomic mass decreases
C.number of valence electrons increases
D. atomic number decreases
I need help filling in the blank boxes and any other box i got wrong
Which is located inside the lung?
O the larynx
O the pharynx
O the trachea
O the alveoli
1 answer choice
Answer:
d is the answer
Explanation:
there you go have a good day
Within the lung are the alveoli. The larynx, sometimes known as the voice box, contains your vocal chords. The inhaling & exhalation of air supplied results in voice sounds.
What are the lungs used for?Respiration, a process of gas exchange, is the major purpose of the lungs (or breathing). In the process of respiration, dioxide, a waste material of metabolism, exits the blood and oxygen from the incoming air enters. Decreased lung function refers to the lungs' diminished mental capacity to transfer gases.
Do your lungs ever ache?Since the lungs lack pain receptors, it's not the lungs itself that hurt when someone suffers painful respiration. But illnesses that impact the heart, kidneys, joints, and muscles
To learn more about: Lungs
Ref: https://brainly.com/question/19135226
#SPJ2
During a recent trip to Northern Europe you find 3 geographically isolated white-flowered strains, called A, B and C, of a rare species of wild rose, C. godshalkae, that usually produces red flowers. You suspect that these strains each arose independently. To gain insight into the origins of the white color, you collect individuals from the different locations and cross them. You show that the mutation that produces white flowers is recessive in each case. A. Your cross of strain A X strain B produces offspring with red flowers. How do you explain this result
Answer and Explanation:
Due to technical problems, you will find the correct answer and explanation in the attached file
1. Which model best illustrates the formation of blood cells? A- dissected pig B- plastic bone C- photograph of a bone D- computer-generated model
Answer:
D- computer-generated model
Explanation:
Computer models are widely used to show real-life situations. Many biological, physical, chemical and engineering processes are easily simulated using a powerful computer system.
Therefore, the formation of blood cells can also be adequately simulated using a powerful computer system, hence the answer above.
Answer:
It's D
Explanation:
What are the adaptations of a wind pollinated flower?
The main adaptations of wind-pollinated plants are: The flowers are small inconspicuous, lacks fragrance and nectar. They are not attractive colors. The perianth lobes are reduced. The pollen grains are smooth, light, and dry. Usually bears unisexual flowers.
Organisms that belong to the same class must belong to the same:
Answer
The taxonomical classification of organisms follows this list of categories
Kingdom
Phylum
Class
Order
Family
Genus
Species
The number of organisms decrease from the top(Kingdom)to the bottom(Species).
Order Phylum is the answer
A herd of cows is an example of which of the following?
*
Community Population
Organism biosphere
types of microorganism and examples of them
Answer:
bacteria- salmonella, E. Coli
archaea- Acidilobus saccharovorans, Aeropyrum pernix
fungi- Mushrooms, yeast, and molds
protozoa- flagellate Trypanosoma
algae-green algae and brown algae
viruses- smallpox, flu
1. Which of the following is a micronutrient?
your answer is
I hope it will helpful for you
please mark as brainest answer
thank you
List 4 different ways microorganisms affect our daily lives.
What is the value of 6.74×106 when written in decimal form?
Answer:
714.44
Explanation:
First do 674x106 which is 71444. Then add in your decimal point which has two numbers after it so add it in the same spot from the right.
Answer:
0.063584906
Explanation:
Divide 6.74/ by 106= 0.063584906
Psychology is considered as what
type of science?
A. Medical
B. Historical
C. Social
Answer:
social
Explanation:
hope this helps!
Oxygen was added to early earth’s atmosphere through
Answer:
Hey There!!
You can say that...
Oxygen was added to early earth’s atmosphere through PHOTOSYNTHESIS!
Explanation:
The introduction of organisms which respired with the Sunlight and CO2 through PHOTOSYNTHESIS had brought a change in the Earth's early atmosphere...
PHOTOSYNTHESIS produces OXYGEN as a waste product (it's not needed by the organism)
This Oxygen is then released into the atmosphere where it was either converted into OZONE or left to move around the rest of he atmosphere...
I HOPE THIS HELPS WITH YOUR WORK!
:D
According to the video, Veterinary Inspectors try to protect humans from
Diseases carried but animals.
Animal bites and scratches.
Wild animals.
Large animals such as horses, cows, or pigs.
Answer:
A
Explanation:
According to the video, Veterinary Inspectors try to protect humans from diseases carried out animals.
What is Vetenary Science?
Vetenary Science is an area of medicine that deal with the scientific study of health and disease in animals. Veterinary science deals with the treatment different animals such as domestic animals and animals that are rested by farmers.
A Vetenary doctor is skilled in the diagnosing diseases and ailments of animals. Their field cover some area of medicine such:anatomy, parasitology gastroenterology. Biosecurity is the protection of human and animal health and the environment from the entry of diseases. It provides different measures against the diseases.
Microorganisms which is also known as microbes are organisms that cannot be seen with our open eyes. Microorganisms are microscopic in nature and they exist as unicellular, multicellular.
Therefore, According to the video, Veterinary Inspectors try to protect humans from diseases carried out animals.
Learn more about diseases on:
https://brainly.com/question/8611708
#SPJ6
Which of the following is not a nucleotide?
GTP
ATP
RNA
CAMP
the following is not a nucleotide is RNA
what are good sources of unsaturated fats?
Answer:
Saturated Fats, Here are 10 high-fat super foods that are actually incredibly healthy and nutritious.
Explanation:
1. Avocados:
Avocados are a fruit, with fat at 77% of calories. They are an excellent source of potassium and fiber, and have been shown to have major benefits for cardiovascular
2. Cheese:
Cheese is incredibly nutritious, and a single slice contains a similar amount of nutrients as a glass of milk. It is a great source of vitamins, minerals, quality proteins and healthy fats.
3. Dark Chocolate:
Dark chocolate is high in fat, but loaded with nutrients and antioxidants. It is very effective at improving cardiovascular health.
4. Whole Eggs:
Whole eggs are among the most nutrient dense foods on the planet. Despite being high in fat and cholesterol, they are incredibly nutritious and healthy.
5. Fatty Fish:
Fatty fish like salmon is loaded with important nutrients, especially omega-3 fatty acids. Eating fatty fish is linked to improved health, and reduced risk of all sorts of diseases.
6. Nuts:
Nuts are loaded with healthy fats, protein, vitamin E and magnesium, and are among the best sources of plant-based protein. Studies show that nuts have many health benefits.
7. Chia Seeds:
Chia seeds are very high in healthy fats, especially an omega-3 fatty acid called ALA. They are also loaded with fiber and minerals, and have numerous health benefits.
8. Extra Virgin Olive Oil:
Extra virgin olive oil has many powerful health benefits, and is incredibly effective at improving cardiovascular health.
9. Coconuts and Coconut Oil:
Coconuts are very high in medium-chain fatty acids, which are metabolized differently than other fats. They can reduce appetite, increase fat burning and provide
10. Full-Fat Yogurt:
Real, full-fat yogurt is incredibly healthy.
It has all the same important nutrients as other high-fat dairy products.
But it’s also loaded with healthy, probiotic bacteria, that can have powerful effects on your health.
Studies show that yogurt can lead to major improvements in digestive health, and may even help fight heart disease and obesity.
Unfortunately, many of the yogurts found on store shelves are low in fat, but loaded with added sugar instead.
It is best to avoid those like the plague.
The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces)
Answer:
LVAAMQLLLLLFLLLFFLV
Explanation:
Transmembrane domains are hydrophobic regions inserted into the cell membrane, while surrounding protein regions are often designed to localize on opposite sides of the membrane. In general, hydrophobic amino acids are inserted into the hydrophobic core of the membrane. These hydrophobic residues have side-chains which are insoluble in water. Examples of hydrophobic amino acids, such as those observed in the putative hydrophobic transmembrane region, include leucine (L), valine (V), alanine (A), methionine (M) and phenylalanine (F).
Students in a science class were asked to investigate how missing or damaged organelles affect cellular homeostasis for cells found in muscle tissues. Which of the following questions should they ask to determine if these muscle cells are functioning properly? A. At what rate does the cell wall need to break down its carbohydrate structure to meet the high energy needs of the cell? B. At what rate do the mitochondria of the cell need to convert glucose to usable energy molecules to meet the high energy needs of the cell? C. At what rate do the ribosomes of the cell need to work to produce enough glucose to meet the high energy needs of the cell? D. At what rate do the chloroplasts of the cell need to capture enough sunlight to meet the high energy needs of the cell?
Answer:
B. At what rate do the mitochondria of the cell need to convert glucose to usable energy molecules to meet the high energy needs of the cell?
Explanation:
Asking scientific questions is the bedrock of scientific investigations. In this case, investigation on how missing or damaged organelles affect cellular homeostasis for cells found in muscle tissues is being carried out. Hence, an appropriate question will be that which suits organelles found in muscle cells.
Mitochondrion is an organelle responsible for the synthesis of usable energy in form of ATP in eukaryotic living cells like animal muscle cells. It is therefore an organelle found in muscle cells. An appropriate question will, therefore, be: At what rate do the mitochondria of the cell need to convert glucose to usable energy molecules to meet the high energy needs of the cell?
Note that other options are wrong because, cell wall and chloroplast are not found in muscle cells, while ribosomes are not organelles for production of glucose.
The apple maggot is a pest of hawthorn plants and apple trees. Before the introduction of apple trees 200 years ago, apple maggot flies laid their eggs only on hawthorns. After the introduction of apple trees, these flies started to lay eggs in apples or hawthorns. These flies tend to live and reproduce in the type of plants they were born in. Therefore, hawthorn flies tend to mate with other hawthorn flies and apple flies tend to mate with other apple flies. Some genetic differences are currently found between these two groups of flies. If these flies become different species in the future, this will be an example of what
Answer:
It is an example of the evolution of species, the adaptation of the fittest as mentioned by Charles Darwin when analyzing the Galapagos Island.
Explanation:
We call this process where the fittest evolve and the least adaptive die out, we call natural selection.
Which of the following experimental treatments would NOT be a potentially effective strategy to inhibit or prevent cell-cell adhesion? Which of the following experimental treatments would NOT be a potentially effective strategy to inhibit or prevent cell-cell adhesion? removal of calcium ions from the extracellular space application of a protease that specifically destroys CAMs application of an antibody that inhibits the function of lectins adding an antagonist to prevent integrin function
Answer:
adding an antagonist to prevent integrin function
Explanation:
An antagonist is a drug capable of binding to a specific receptor, thus blocking the binding of endogenous ligand molecules. According to their mode of functioning, the antagonists are classified into four classes: chemical, physiological, competitive and non-competitive. Integrins are specific transmembrane receptors that facilitate cell adhesion. In consequence, in the case above indicated, the use of an antagonist for the integrin receptor will prevent cell adhesion.
In the equation, C6H12O6 is a
Answer:
Glucose
Explanation:
What is the volume of the rectangular prism?
Answer:
270cm³
Explanation:
Volume of the rectangular prism: length * width * height.
In this case: 6cm * 9cm * 5cm
Fossil fuels are formed when organic materials decompose and sendiments are deposited on top of them.This process of sediments accumulation over time leads to________of the sediments.
Oil
Explanation:
The process of sediment accumulation over time leads to Oil
what is the name of a process that produces use to make their own food
Answer:
Photosynthesis
Explanation:
Photosynthesis. Plants are autotrophs, which means they produce their own food
I hope this helps.
