Seven is not an example of _____. A) an expression B) a term C) a variable D) a constant

Answers

Answer 1

Answer:

Seven is not an example of variable bcz variable are the letters like x,y and z.

Step-by-step explanation:

hope it help ^_^

Answer 2

seven is not an example of a variable.

The correct answer is an option (C).

What is a constant?

"A quantity that has a fixed numerical value."

What is variable?

"A letter or symbol whose value may changes."

What is an expression?

"It is a mathematical statement which consists of constant, variable and some mathematical operations"

What are terms?"These are the values on which the mathematical operations take place in an expression.""It can be a constant or a variable or both"

For given question,

Seven is not an example of a variable.

Seven is fixed number, it's value cannot be changed.

Seven is an example of a constant.

Also, it is an example of a term and an expression.

Therefore, seven is not an example of a variable.

The correct answer is an option (C).

Learn more about variable here:

https://brainly.com/question/17367653

#SPJ2


Related Questions

12x2= plz get it right plz

Answers

it is 24

12x2=12+12=24

K is the midpoint of JL. JK = 2x + 5 and JL = 50.
To solve for x, Steve sets up the following equation: 2x + 5 = 50
Explain the error in Steve's equation.

Answers

steve set the equation equal to 50 which is the entire length of JL. instead he should've set the equation equal to 25, since it's half of 50 and would represent the midpoint. he should've said 2x + 5 = 25

4x + 3 = -5

Solve in two steps

Answers

Answer:

x=2

Step-by-step explanation:

4x+3=-5

STEP ONE: subtract 3 from both sides

4x=-5-3

STEP 2: divide both sides by 4

4x=-8

x=-2

The corvette answer to this is -2 I think sooo yeaaa

A baseball diamond is a square that measures 90 feet on each side. How far does the third baseman have to throw the ball to reach first base?
pls help ​

Answers

Answer:

127.28

Step-by-step explanation:

The formula for the diagonal of a square is:

Diagonal = The square root of: 2, multiplied by the length of one side.

Graph the line.
y+2x = -2
x
-6
2
4
6
00
can someone help me with this??

Answers

Answer:

below

Step-by-step explanation:

I graphed the function using a graphing tool

If ABF= (7x + 20), FBC=(2x - 5), and ABC= 159", find the value of x. x =

Answers

Given :

∠ABF = ( 7x + 20 )°

∠FBC=(2x - 5)°

∠ABC= 159°

To Find :

The value of x .

Solution :

Assuming B the center of a circle .

So , all three given angles must be added to 360° .

[tex](7x+20)+(2x-5)+159=360\\\\9x+15+159=360\\\\x=20.67[/tex]

Therefore , the value of x is 20.67° .

Hence , this is the required solution .

how do i find the volume of this shape

Answers

Answer:

Finding the exact volume is physically impossible, however, you can find a rough estimate by calculating side lengths and that stuff

Step-by-step explanation:

sum of the numbers m and n decreased by their product; write the algebraic expression​

Answers

Answer:   m+n-mn

You can write mn as m*n

=================================

Explanation:

The sum is the result of adding two or more numbers. Saying the sum of m and n means m+n.

Then we subtract off the product of m and n. The product is the result of multiplying m and n. We say m*n or mn to indicate their product.

Overall, we end up with m+n-mn

Find the number that makes the 2 fractions equivalent 3/8=9/?

Answers

Answer:

24

Step-by-step explanation:

The numerator of the equivalent fraction of 3/8 is 9. From this, we can see that the common factor that is being multiplied is 3. So the denominator, 8, has to be multiplied by 3 as well which gives you 24. 9/24 is an equivalent fraction of 3/8

Answer:

Step-by-step explanation:

3/8 = 9/x

3x = 72

x = 24

Can all lines contain line segments in them?

Answers

Answer: No

Step-by-step explanation: Because not all lines can have to end ponits some needs to go on forever like infinte and not be stop by the end points Hope this is the answer your looking for :).

10 < 3x + 19
Help ASAP time is running out !

Answers

Answer:

-3<x

Step-by-step explanation:

10 < 3x + 19

10 - 19 < 3x

-9 < 3x

-9/3 < x

-3 < x

Answer:

-3 < x

Step-by-step explanation:

Subtract 19 both sides, divide by 3

what is the answer to
-4 + 7 = ___

Answers

Answer: 3

Step-by-step explanation:

Which of the following correctly uses absolute value to show the distance between −70 and 15? (5 points) |−70 + 15| = |−55| = −55 units |−70 − 15| = |−85| = −85 units |−70 − 15| = |−85| = 85 units |−70 + 15| = |−55| = 55 units

Answers

Answer:

the answer is |−70 − 15| = |−85| = 85 units [ C ]

hope this helps :)

Step-by-step explanation:

What are the 8 exponent laws?

Answers

Answer:

Step-by-step explanation:

Answer:

Product rule Power rule Quotient rule Negative exponent ruleZero exponent rule Adding/subtracting (like terms only).

Step-by-step explanation:

One Rule ; [tex]x^1 =x[/tex]

Zero Rule [tex]x^0 =1[/tex].

Product Rule ; [tex]x^m x^n = x^m^+^n[/tex]

Quotient Rule;  [tex]x^m/x^n = x^m^-^n[/tex]

Power Rule; [tex](x^m)^n=x^m^n[/tex]

Tower Rule [tex]a^{m^n}[/tex]

Fraction Rule [tex]a^\frac{1}{n} =\sqrt[n]{a^1}[/tex]

Is -9 rational, integer, whole, natural, or irrational?

Answers

Answer:

it is a rational, and integer

Answer:

Now according to the definition, 0 is a real number, a rational number, an integer and also a whole number but neither an irrational number nor a natural number. Answer: 0 is a rational number, an integer and also a whole number but neither an irrational number nor a natural number

Step-by-step explanation:

Hope this helps

what is the greatest and least number that can be rounded to 120,000

Answers

Answer:

119,999

Step-by-step explanation:

hope it helps

f(x)=2x-2
Find f(3b)

Answers

Answer: 6b-2

Substitute 3b for x
2(3b)-2
6b-2 but can also be written as 2(3b-1)

describe the best answer for kx+3x=4 when solving for x

Answers

Answer:

x = [tex]\frac{4}{k+3}[/tex]

Step-by-step explanation:

Move all terms to the left side and set equal to zero. Then set each factor equal to zero.

A bow of chocolates contains 18 chocolates squares. Ten of those squares are milk chocolate, 5 are dark chocolate, and 3 are whit chocolate. If Christina randomly chooses a chocolate out of the box, what is the probability of her choosing a white chocolate square?

Answers

I’m pretty sure it is 3/26. Hope that helps!

There are two green boxes and two red boxes. How many possible ways are there of arranging the boxes in a row?

A. 4
B. 6
C. 12
D.24

Answers

Four, they said my answer has to be atleast 20 characters long so djdbdbdbdbdbdbdhdbdbdbdhdbdhdhdhdhdhdhdhdhdhdhdhhdhd

How do you find the answer to (6-4)2-5

Answers

Answer:

You would do the (6-4) first (2), then you are left with 2-5 and you get -3. Now you multiply (2) times -3 and you get -6

Step-by-step explanation:

.Rebecca's volleyball team is purchasing jerseys. The company charges $150 for a one time set-up fee and $25 for each printed jersey. Which expression represents the total cost of x number of jerseys for the team? *
2 points

Answers

Answer:

y= 25x+150

Step-by-step explanation:

x is the constant rate,which is 25.

and y is the starting number which is 150

1/3,-1,☑8,4.5 which ones greater?

Answers

Answer:

8

Step-by-step explanation:

Arrange the terms in ascending order.

[tex]-1, \frac{1}{3}, 4.5, 8[/tex]

The maximum value is the largest value in the arranged data set.

8

What is the name of the transformation in which each point on a figure is turned through a given angle and direction around a given point?

Answers

Answer:

angle of rotation

Step-by-step explanation:

The name of the transformation whereby each point on a figure is turned around a given point is: rotation.

What is Rotation?

Rotation is a form of transformation whereby a figure is turned either clockwise or counterclockwise direction on a coordinate plane.

During rotation, the shape and size of the original figure remains the same.

Thus, the name of the transformation whereby each point on a figure is turned around a given point is: rotation.

Learn more about rotation on:

https://brainly.com/question/26249005

1. Define a Transformations and a reflection. What is the
difference between them?

Answers

Answer:

More advanced transformation geometry is done on the coordinate plane. The transformation for this example would be T(x, y) = (x+5, y+3). A reflection is a "flip" of an object over a line.

The temperature at 9:00 AM was 42°F. The temperature dropped 9 degrees per hour for the next seven hours. What is the temperature at 4:00 PM?

Answers

Hey there! I'm happy to help!

Let's call our hours h. Here is what we have going on.

42-9h

4:00 PM is 7 hours after 9:00 AM. So, we will replace the h with 7 and evaluate.

42-9(7)

42-63=-21

Therefore, the temperature would be -21°F.

Have a wonderful day! :D

find the are of the square 3.5

Answers

Answer:

1.87

Step-by-step explanation:

The temperature at 7:00 a.m. was –5°F. By 4:00 p.m., the temperature had risen 9 degrees and by 10:00 p.m. the temperature dropped 11 degrees. What was the temperature at 10:00 pm

Answers

Answer:

-7 degrees

Step-by-step explanation:

-5+9-11=-7

list some odd numbers less than 21

Answers

Answer:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31

Step-by-step explanation:

Answer:

1,3,5,7,9,11,13,15,17,19

what is the sum of this arithmetic series?

Answers

The sum of this arithmetic series is 52.

Answer:

52

Step-by-step explanation:

The ' easiest' method here is to substitute k = 1, 2, 3, 4 into the expression and sum the terms, that is

(- 2 + 6(1) ) + ( - 2 + 6(2) ) + ( - 2 + 6(3) ) + (- 2 + 6(4) )

= (- 2 + 6) + (- 2 + 12) + (- 2 + 18) + (- 2 + 24)

= 4 + 10 + 16 + 22

52

Other Questions
The legislative branch is..a.responsible for enforcing the lawb.divided into two seperate houses c.accountable for conducting trialsd.less powerful than the executive Which of the following verbs is reflexive?hablarcomervivirlevantarse Precision Manufacturing had the following operating results for 2014: sales = $38,900; cost of goods sold = $24,600; depreciation expense = $1,700; interest expense = $1,400; dividends paid = $1,000. At the beginning of the year, net fixed assets were $14,300, current assets were $8,700, and current liabilities were $6,600. At the end of the year, net fixed assets were $13,900, current assets were $9,200, and current liabilities were $7,400. The tax rate for 2014 was 34 percent. What is the cash flow from assets for 2014? State whether the following sentences are true or false regarding the nature of fiduciary-type funds and the accounting measurements within them. If the sentence is false, state why. a. Governments may access the resources of fiduciary funds to help support their own programs. b. When a government sponsors an Investment Trust Fund, the portion that belongs to other governments is reported as assets of the Fund, but the portion belonging to the sponsoring government is not. c. The statement of net position for a typical Agency Fund shows assets and liabilities, but no fund balance. d. When reporting on the resources of Pension Trust Funds, equity securities held by the Funds are reported at original cost. The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces) Which region in georgia is deepwater parts found in how does the author use of the word tusk inform the reader the angles of a qaudileteral are x,2x,100 and 110 degress find the value of 2x Helppppppppppppppppp Every weekday after tennis practice, Will buys either a carton of milk or a bottleof power drink.Suppose that m is the number of cartons of milk that Will purchased duringthe last month. His total cost for beverages in dollars last month can berepresented by the algebraic expression 2m + 3 (20 m).Which of the following statements are true? Select all that apply.The cost of the power drink is $3 per bottle,Will purchased 20 more bottles of power drink than cartons of milk.Will purchased a total of 20 beverages during the last month.The total amount Will spent on power drinks was $60An equivalent expression for the total cost of Will's beverages during this month is60 - m dollarsWill purchased 20 more cartons of milk than bottles of power drink Determine the account balance of a simple interest account if the principal is $10,000, the interest rate is 1.5%, and the time is 5 years. from chapter 3 of animal farm the pigs set aside the harness room as a headquarters for themselves whay does this foreshadow? Psychology is considered as whattype of science?A. MedicalB. HistoricalC. Social uppose you are titrating an acid of unknown concentration with a standardized base. At the beginning of the titration, you read the base titrant volume as 2.04 mL. After running the titration and reaching the endpoint, you read the base titrant volume as 20.95 mL. What volume, in mL, of base was required for the titration? what has led nepal to be rich in customer and tradition Write 6/16 in lowest terms Live Trap Corporation received the following data for its rodent cage production unit. OUTPUT INPUT 50,025 cages Production time 652 labor hours Sales price: $3.60 per unit Wages $ 7.60 per hour Raw materials (total cost) $ 31,550 Component parts (total cost) $ 15,900 Find the total productivity in Units Sold and Dollars of Sales per Dollar Input. (Round your answers to 2 decimal places How is this model useful?O It shows how electrons are distributed in the shells of an iron atom.O It shows how electrons are distributed in the shells of a cobalt atom.o It shows how orbitals are distributed in the shells of an iron atom.It shows how orbitals are distributed in the shells of a cobalt atom. Find four consecutive even integers whose sum is 100 what are the integers Unlike velocity, speed is scalar, which means it is described by