Which musical term means a particular type of music with a distinctive form or sound?

Answers

Answer 1

Answer:

classical music. a style of "art" music that stands apart from traditional or popular music. genre. a term designating a particular type of music with a distinctive form or sound.

Answer 2

Answer: Classical music. a style of "art" music that stands apart from traditional or popular music. genre. term designating a particular type of music with a distinctive form or sound


Related Questions

Research a current trend of your choice and write a short report on how this trend has influenced the development of cuisine.

Answers

Answer:

The Travis Scott

630 Cal

Travis Scott’s favorite McDonald’s burger features a ¼ lb.* of 100% fresh beef topped with onions, pickles and two slices of melty cheese, plus ketchup and mustard. Seem like a standard Quarter Pounder®* with Cheese? Nah, it’s also got shredded lettuce and crispy bacon because that’s how Cactus Jack likes it (straight up!). We recommend getting the whole Travis Scott Meal, because honestly...it slaps. Order it today with Mobile Order & Pay in the McDonald’s App.

Explanation:

Answer:

Consumer purchasing patterns are influenced by food trends. Dietitians who keep their finger on the pulse of consumer food buying trends can help firms and brands stay popular by guiding them on the right path.

With the recent focus on food and nutrition, businesses are turning to dietitians for help separating fact from fiction and determining the best messaging for their products and brands. Many food and nutrition trends formerly exclusively seen among core natural consumers are moving into the mainstream limelight. 

Explanation:

Which of the following is true about the serve?

Answers

Wait what following?

In the above painting, what message was the artist, Antoine-Jean Gros, trying to spread?
a.
He intended to portray Napoleon as a compassionate and giving leader, who was not afraid to be among the sick and poor.
b.
He wanted to portray the horrors caused by the outbreak of the bubonic plague in 1799.
c.
He wanted to show the devastation experienced by the people during the Napoleon Wars, while at the same time show the people’s fortitude and love for Napoleon,
d.
He intended to show Napoleon as a Christ-like figure, healing the sick with his touch.

Answers

Answer:

C its c

Explanation:

Answer:

D

He intended to show Napoleon as a Christ-like figure, healing the sick with his touch.

List the four workplace trends discussed in the lecture

Answers

Answer:

work flexibility, anti-harassment practices, and pay transparency.

Explanation:

because i said it is yw :)

1. It is important for a playwright to be able to
a. publish a play.
b. develop skill to create interesting character relationships.
C. develop the skill to write strong narrative.
d. create a concise plot.

Answers

Answer:

it is a

Explanation:

because i am learning about this also

write with your own words the life of the Bethoveen and the his best composition.​

Answers

Answer:

Ludwig Van Beethoveen was born in 1770 in Bonn, Germany as the son of a court musician. His talent for the piano was soon realized and he gave his first public performance at the age of eight. ... It turns out that events in Beethoven's life greatly affected (or seem to have affected) him writing.

Explanation:

Which word is a SYNONYM for tolerant?
Although criticized for its own customs, the native population was tolerant of other cultures.
indifferent
unaware
accepting
forgiving

Answers

Answer:

indifferent

Explanation:

HURRY PLEASE!!!!!
Which statement about Donatello's sculptures is true?


A.) Some show subjects used in ancient Egyptian art.


B.)Some show subjects used in ancient Roman art.


C.) Some show subjects used in American Indian art.

Answers

Answer:

B.) Some show subjects used in ancient Egyptian art

Explanation: sorry if it is wrong

I think it might be a or b :)

Is it bad to listen to music while studying and doing homework?
A.) I agree
B.) I disagree

Answers

Answer:

A i love listening to music while doing my school work

some benefits are that it is Proven to improve brain functions

Perhaps one of the most compelling reasons to listen to music during a study session is because music is proven to help improve cognitive performance. Basically, music helps your brain function! “Background music may enhance performance on cognitive tasks

Explanation:

Medium is _____________________

Answers

Answer:

the material of a work of art.

OR in painting: the substance that is added to a color in order to help application

Explanation:

Answer:

a version of something, like the story of Narsissus, if you look up videos for it on yt, you'll find a bunch of different people telling it in different ways, but still getting the point across.

or it could be a size.

or it could be a material used to create something, like in a painting, the mediums would be paint, and maybe sharpie if you outlined what you painted.

Brainliest?

​The convention of representing animals’ horns in twisted perspective in cave paintings or allowing the viewer to see the head in profile and the horns from the front is termed ____________.

a. optical

b. fanciful

c. descriptive

d. true

Answers

The answer for this question is (D)

what colors mixed make purple

Answers

Answer:

Cold blue and warm red

Explanation:

Make purple

mix two primary colors red and blue

How many eyes can fit on a average adults hear and where would u place the eyes when drawing a portrait

Answers

Answer:

the answer is everything in the picture.

Explanation:

you're welcome

Answer:

Which statements describe the prime meridian? Check all that apply.

makes a half circle on Earth

makes a full circle on Earth

divides Earth into Northern and Southern Hemispheres

divides Earth into Eastern and Western Hemispheres

connects the north and south poles

connects the Northern and Southern Hemispheres

Explanation:

Why is Gormley so focussed on the human form and his own body in particular?

Answers

Answer: Gormley is so focussed on the human form and his own body in particular because he wants to know what is the nature of the space a human being inhabits.

Explanation: Over the years Gormley has expanded into casting other people and large community projects. He has been recognised with the 1994 Turner Prize and an OBE and works such as Field, with its thousands of tiny clay figures staring so affectingly at the viewer, and his monumental Angel of the North have become some of the best-known contemporary art of the last few decades. Gormley's latest work to be shown in the UK, Another Place, again draws on his own body for the 100 cast-iron figures, made from 17 slightly different moulds, that will face the open sea for 3km either side of the tideline on Crosby Beach on Merseyside. The work deals with the theme of migration as the figures look out at a new horizon, but the complex administrative arrangements in staging it - he has had to come to an accommodation with a "horrendous variety of authorities", including the coastguards, the RSPB and various local government agencies - has also raised interesting questions.

one of the first successful female playwrights was also this covert profession. Who was she and what was her other profession ?​

Answers

Answer:

So the spy whose true name was Aphra Behn turned to an equally unlikely profession to save herself from debtors' prison: writing. The social world that allowed a woman to be first a spy, then a financially successful playwright and poet was one of enormous upheaval

What is the painting name?

Answers

Answer:

baco en el arte

Explanation:

i saw this and yep

What is the central question of the philosophy of art?

A. Who can be an artist?

B. What is art?

C. Why does art exist?

D. How should artists live their lives?

Answers

Answer:

B. What is art?

Explanation:

What is art? is the central question of the philosophy of art. Thus, option B is correct.

What is the philosophy of art?

A significant communicating function is also served by art. Through it, people are able to share their most private, intimate, and profound ideas with one another. The great deal of intellectual, moral, and social content that both disciplines include is a shared characteristic.

People are able to share their most private, intimate, and profound ideas with one another. The abundance of cognitive, upright, and social content that both philosophical and artistic endeavors include is a shared characteristic.

The theory of art is evoking specific religious or psychological moods in the viewership or figuratively portraying them. Therefore, option B is the correct option.

Learn more about the philosophy of art, here:

https://brainly.com/question/17694468

#SPJ5

What should i add to this if i'm making this into an suit?

Answers

Answer:

the type of cloth that will be easy to work with and breathe in , and maybe eyes that you can look out of like maybe like tennis shoes holes so you can look out

Its a nice start. You should add some hair to the top of their head to give it some character. Try making the tail extra fluffy and making the eyes big so you can see better ( also makes them look cuter)

Love the fursuit idea! Good luck :D

Name the painting above and its artist.

Answers

Answer:

Claude Monet, Haystack in winter at Sunset

Explanation:

Claude Monet for sure

can someone tell me the lyrics to impossible need it for assignment thx

Answers

Answer:

Mm

Oh

Oh

Yeah

Mm

I remember years ago

Someone told me I should take

Caution when it comes to love, I did

And you were strong and I was not

My illusion, my mistake

I was careless, I forgot, I did

And now

When all is done, there is nothing to say

You have gone and so effortlessly

You have won, you can go ahead, tell them

Tell them all I know now

Shout it from the rooftops

Write it on the skyline

All we had is gone now

Tell them I was happy

And my heart is broken

All my scars are open

Tell them all I hoped would be impossible

Impossible

Impossible

Impossible

Hey

Falling out of love is hard

Falling for betrayal is worse

Broken trust and broken hearts

I know, I know

And thinking all you need is there

Building faith on love and words

Empty promises will wear

I know

I know and now…

Explanation:

IS THIS IT...

Answer:

Mm

Oh

Oh

Yeah

Mm

I remember years ago

Someone told me I should take

Caution when it comes to love, I did

And you were strong and I was not

My illusion, my mistake

I was careless, I forgot, I did

And now

When all is done, there is nothing to say

You have gone and so effortlessly

You have won, you can go ahead, tell them

Tell them all I know now

Shout it from the rooftops

Write it on the skyline

All we had is gone now

Tell them I was happy

And my heart is broken

All my scars are open

Tell them all I hoped would be impossible

Impossible

Impossible

Impossible

Hey

Falling out of love is hard

Falling for betrayal is worse

Broken trust and broken hearts

I know, I know

And thinking all you need is there

Building faith on love and words

Empty promises will wear

I know

I know and now…

I hope this helps you!

Refer to the article "Harun al-Rashid & One Thousand and One Nights." How does the passage develop the idea that Scheherazade is a clever wife?

A. She creates suspense with her stories.
B. She tells stories on many subjects.
C. She uses her stories to keep herself alive.
D. She is a gifted storyteller.

Answers

Answer: C. She uses her stories to keep herself alive.

Explanation:

Harun al-Rashid & One Thousand and One Nights tells the story of King Shahryār of Persia who was betrayed by his first wife and so believed all women to be betrayers who would betray him eventually. He would therefore marry a new woman every night and kill her the next day so it would not happen. He did this to 3,000 women.

This happened until the well read and knowledgeable daughter of the Vizier spent the night with him. She told him a story which was so good that he asked for another. She replies that there was no time as day was about to break. He then keeps her alive so she tells a story and this she does for a thousand and one nights and became his queen.

Interpretation for the last supper by Leonardo de Vinci

Answers

Answer:

Lo

LOLLOLOLOLO

Explanation:

In painting the Last Supper, Leonardo created the effect that the room in which Christ and the apostles are seen was an extension of the refectory. ... As far as the composition is concerned, Christ is in center among the apostles, and his body forms a triangle-like shape which is not overlapped by any apostles.

Where would A/V technicians be most likely to work? environmental center preschool stadium freeway

Answers

Pre school or stadium. Their job is to repair, set up, and operate equipment that can be used in entertainment shows, schools, etc.

How does Leonardo da Vinci’s technique of sfumato work?

Answers

Answer:

The technique is a fine shading meant to produce a soft transition between colors and tones, in order to achieve a more believable image. ... Leonardo Da Vinci described the technique as blending colors, without the use of lines or borders "in the manner of smoke".

Answer:

it creates a gentle transition form one image to another by outlining them in a fine haze

Explanation:

Although art can be just about anything, there is one defining feature that
connects all works of art ever made. What is it?
A. Art is only found in museums.
B. Art always tries to show things as they really are.
C. Art must be purchased before it is worth anything.
D. Art always has meaning.

Answers

Answer: D

Explanation:
The correct answer is d like the other guy said

When you paint do you let your mind take over what you do sometimes?

Answers

Answer:

yes and no

Explanation:

i'm aware of what i'm doing when i'm painting.sometimes i let myself go though,sometimes i cant bc its risky.but most of the time i'm in control of myself when i paint.unless i need to get something out.Like an idea for a really good idea.. :)

Why do you think artist use musical imagery so frequently in their compositions? How do u think these two disciplines ...

Answers

To daydream. That’s the answer

What is this sign called?
A. Repeat sign
B. Accent sign
C. Final barline
D. Double barline

Answers

Answer:

A.a repeat sign

Explanation:

i play trumpet , violin and ukulele . it's Definitely a repeat sign

Answer:

A. Repeat sign

Explanation:

what is a line????? (in art btw)

Answers

Line is the path created when an object moves from one point to another. In the visual arts, lines are made when you draw or paint marks on a paper, canvas, or when materials such as wood, glass and metal are bent or shaped. ... Lines can be horizontal, vertical or diagonal, straight, curved or free-form

HELP PLZ!!!
Which of the following might an ethnomusicologist study?
A. String performance techniques of the seventeenth century
B. Orchestration
C. Javanese Gamelan music
D. Twentieth century notational practice

Answers

The answer is Javanese Gamelan music
Other Questions
Which of Hidesatos traits is demonstrated in this excerpt and is characteristic of a folktale? my daughters homework is killing me short read Which is the solution set of: 5(x+3)10x>10? The legislative branch is..a.responsible for enforcing the lawb.divided into two seperate houses c.accountable for conducting trialsd.less powerful than the executive Which of the following verbs is reflexive?hablarcomervivirlevantarse Precision Manufacturing had the following operating results for 2014: sales = $38,900; cost of goods sold = $24,600; depreciation expense = $1,700; interest expense = $1,400; dividends paid = $1,000. At the beginning of the year, net fixed assets were $14,300, current assets were $8,700, and current liabilities were $6,600. At the end of the year, net fixed assets were $13,900, current assets were $9,200, and current liabilities were $7,400. The tax rate for 2014 was 34 percent. What is the cash flow from assets for 2014? State whether the following sentences are true or false regarding the nature of fiduciary-type funds and the accounting measurements within them. If the sentence is false, state why. a. Governments may access the resources of fiduciary funds to help support their own programs. b. When a government sponsors an Investment Trust Fund, the portion that belongs to other governments is reported as assets of the Fund, but the portion belonging to the sponsoring government is not. c. The statement of net position for a typical Agency Fund shows assets and liabilities, but no fund balance. d. When reporting on the resources of Pension Trust Funds, equity securities held by the Funds are reported at original cost. The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces) Which region in georgia is deepwater parts found in how does the author use of the word tusk inform the reader the angles of a qaudileteral are x,2x,100 and 110 degress find the value of 2x Helppppppppppppppppp Every weekday after tennis practice, Will buys either a carton of milk or a bottleof power drink.Suppose that m is the number of cartons of milk that Will purchased duringthe last month. His total cost for beverages in dollars last month can berepresented by the algebraic expression 2m + 3 (20 m).Which of the following statements are true? Select all that apply.The cost of the power drink is $3 per bottle,Will purchased 20 more bottles of power drink than cartons of milk.Will purchased a total of 20 beverages during the last month.The total amount Will spent on power drinks was $60An equivalent expression for the total cost of Will's beverages during this month is60 - m dollarsWill purchased 20 more cartons of milk than bottles of power drink Determine the account balance of a simple interest account if the principal is $10,000, the interest rate is 1.5%, and the time is 5 years. from chapter 3 of animal farm the pigs set aside the harness room as a headquarters for themselves whay does this foreshadow? Psychology is considered as whattype of science?A. MedicalB. HistoricalC. Social uppose you are titrating an acid of unknown concentration with a standardized base. At the beginning of the titration, you read the base titrant volume as 2.04 mL. After running the titration and reaching the endpoint, you read the base titrant volume as 20.95 mL. What volume, in mL, of base was required for the titration? what has led nepal to be rich in customer and tradition Write 6/16 in lowest terms Live Trap Corporation received the following data for its rodent cage production unit. OUTPUT INPUT 50,025 cages Production time 652 labor hours Sales price: $3.60 per unit Wages $ 7.60 per hour Raw materials (total cost) $ 31,550 Component parts (total cost) $ 15,900 Find the total productivity in Units Sold and Dollars of Sales per Dollar Input. (Round your answers to 2 decimal places