Which of the following statements about microarrays is false?A. Microarrys enable scientists to to determine the activity of thousands of genes at once.B. Microarrys use flurescently labeled cDNA molecules to identify particular genes expressed at a particular time.C. Microarrys use tiny portions of double-stranded RNA fragments from a large number of genes.

Answers

Answer 1

Answer: C. Microarrys use tiny portions of double-stranded RNA fragments from a large number of genes.

Explanation:

A DNA microarray) is a solid surface to which a collection of DNA fragments is attached. The surfaces used to fix the DNA are highly variable and can be made of glass, plastic or even silicone. It involves placing thousands of gene sequences in specific locations on a glass slide called a chip. Microarrays basically miniaturizes processes that have been used in molecular genetics laboratories for years. So, a sample containing DNA or RNA is put in contact with the chip, and it allows the detection of DNA or RNA molecules by hybridization or adhesion of the molecules on the slide. The detection of the DNA or RNA adhered is made by different labels or colors that allow them to be detected under the microscope.

Microarrays are usually used to identify genes with differential expression under different conditions. For example, to detect genes that produce certain diseases by comparing expression levels between healthy cells and cells that are developing certain types of diseases. The matching of the complementary bases between the sample and the gene sequences on the chip produces a measurable amount of light. The areas of the chip that produce this light identify the genes that are expressed in that sample.

Then, in summary, the DNA chips are used to analyze the differential expression of genes, and the levels of thousands of genes are monitored simultaneously. And it measures the level of hybridization between the specific probe (probe) and the target molecule (target), indicated by fluorescence and through an image analysis, which indicates the level of gene expression.


Related Questions

a. How many times its own weight did the moss absorb?
b. How does this compare with the paper towel?
c. Why is Sphagnum often used to ship items that must be kept moist?

Answers

Answer:

The correct answer is :

1. many times

2. absorbs more than paper towels.

3. It absorbs any extra water that is around.

Explanation:

mosses are non-vascular plants in the land plant division Bryophyta. They are little herbaceous plants that retain water and other nutrients with the help of their leaves and uses carbon dioxide and daylight to make food by photosynthesis.  The sphagnum cells are very thin wall cells with enormous depressions or cavities which is uses as is to retain and ship water

Thus, the correct answer is :

1. many times

2. absorbs more than paper towels.

3. It absorbs any extra water that is around.

Which material undergoes radioactive decay?

Answers

A material containing unstable nuclei is considered radioactive. Three of the most common types of decay are alpha decay, beta decay, and gamma decay, all of which involve emitting one or more particles or photons.

A material undergoes radioactive decay if it has an atom with unequal number of protons and neutrons.

What is an atom?

An atom is defined as the smallest unit of matter which forms an element. Every form of matter whether solid,liquid , gas consists of atoms . Each atom has a nucleus which is composed of protons and neutrons and shells in which the electrons revolve.

The protons are positively charged and neutrons are neutral and hence the nucleus is positively charged. The electrons which revolve around the nucleus are negatively charged and hence the atom as a whole is neutral and stable due to presence of oppositely charged particles.

Atoms of the same element are similar as they have number of sub- atomic particles which on combination do not alter the chemical properties of the substances.

Learn more about atom,here:

https://brainly.com/question/13654549

#SPJ2

The apple maggot is a pest of hawthorn plants and apple trees. Before the introduction of apple trees 200 years ago, apple maggot flies laid their eggs only on hawthorns. After the introduction of apple trees, these flies started to lay eggs in apples or hawthorns. These flies tend to live and reproduce in the type of plants they were born in. Therefore, hawthorn flies tend to mate with other hawthorn flies and apple flies tend to mate with other apple flies. Some genetic differences are currently found between these two groups of flies. If these flies become different species in the future, this will be an example of what

Answers

Answer:

It is an example of the evolution of species, the adaptation of the fittest as mentioned by Charles Darwin when analyzing the Galapagos Island.

Explanation:

We call this process where the fittest evolve and the least adaptive die out, we call natural selection.

In the equation, C6H12O6 is a

Answers

Answer:

Glucose

Explanation:

What is the maximum number of individuals who could be represented by these bones? Explain your answer. (Hint: Assume every bone in the collection could be from a different person.)

Answers

Osteologists determine the maximum number of individuals based on the total number of pieces found in the remains. In the exposed example, the maximum number of individuals represented by these bones is 22.

-------------------------------------------------------

There is a protocol to follow when finding bones together or close to each other.

1)   Bone's identification. To know which bone each of the pieces represents.

2)   Classification of the bone's origin to know if bones belong to an animal or a human being.

3)   Then the potential number of individuals found should be estimated. This step is one of the most significant ones for osteologists: determine the number of individuals found.

The minimum number of individuals the remains representThe maximum number of individuals the remains represent

Bones might represent as many individuals as pieces there are. Or as many individuals as pieces can form by assembling them.

For instance, if a right femur and a right tibia are found together, the minimal number of individuals is one -because they could belong to the same person-, and the maximum number is two -because each of the bones could belong to a different person-.

Bone's characteristics such as sizes, bilateral traits, staining properties, articular matching, among others, are significant when trying to assembly an individual. However, these clues are not definitive.

Previous data can also be helpful when determining the number of individuals represented by these bones. Knowing the number of dead individuals in this place, ages, sexes, races, etcetera, can make the determination easier.

The most defining analysis to be performed when possible is DNI. A more confident determination on the number of individuals can be done by performing DNI analysis.

In the exposed situation there are 22 pieces, identified as follows

3 skulls6 femurs → 4 of them are right femurs2 right humerus 2 left tibia 4 hip bones → 3 left and 1 right5 scapula → 3 right and 2 left

According to this information, the first assumption should be that each piece of bone represents one single individual.

So, if there are 22 pieces, they might be representing 22 different individuals. This is the maximum number of individuals there might be present.

Since there are four right femurs, we could assume a minimum number of 4 individuals represented by these bones.

------------------------------------------------

Related link: https://brainly.com/question/22401870?referrer=searchResults

                     https://brainly.com/question/13403950?referrer=searchResults

Fossil fuels are formed when organic materials decompose and sendiments are deposited on top of them.This process of sediments accumulation over time leads to________of the sediments.

Answers

Oil

Explanation:

The process of sediment accumulation over time leads to Oil

Which is located inside the lung?
O the larynx
O the pharynx
O the trachea
O the alveoli

1 answer choice

Answers

Answer:

d is the answer

Explanation:

there you go have a good day

Within the lung are the alveoli. The larynx, sometimes known as the voice box, contains your vocal chords. The inhaling & exhalation of air supplied results in voice sounds.

What are the lungs used for?

Respiration, a process of gas exchange, is the major purpose of the lungs (or breathing). In the process of respiration, dioxide, a waste material of metabolism, exits the blood and oxygen from the incoming air enters. Decreased lung function refers to the lungs' diminished mental capacity to transfer gases.

Do your lungs ever ache?

Since the lungs lack pain receptors, it's not the lungs itself that hurt when someone suffers painful respiration. But illnesses that impact the heart, kidneys, joints, and muscles

To learn more about: Lungs

Ref: https://brainly.com/question/19135226

#SPJ2

types of microorganism and examples of them​

Answers

A microorganism is a living thing that is too small to be seen with the naked eye. Examples of microorganisms include bacteria, archaea, algae, protozoa, and microscopic animals such as the dust mite.

Answer:

bacteria- salmonella, E. Coli

archaea- Acidilobus saccharovorans, Aeropyrum pernix

fungi- Mushrooms, yeast, and molds

protozoa- flagellate Trypanosoma

algae-green algae and brown algae

viruses- smallpox, flu

What criteria is used to divide the
earth into layers?
A. Each layer is 10 miles thick.
B. Each layer is 100 miles thick.
C. The age of the rock is determined.
D. It is based on physical and chemical properties.

Answers

C, the age of the rock

How might you go about explaining the problem of climate change to friends and family? How could you encourage them to take climate action?

Answers

Answer:

Can you explain to them why it is not a hoax, because some people believe it is.

Oxygen was added to early earth’s atmosphere through

Answers

Answer:

Hey There!!

You can say that...

Oxygen was added to early earth’s atmosphere through PHOTOSYNTHESIS!

Explanation:

The introduction of organisms which respired with the Sunlight and CO2 through PHOTOSYNTHESIS had brought a change in the Earth's early atmosphere...

PHOTOSYNTHESIS produces OXYGEN as a waste product (it's not needed by the organism)

This Oxygen is then released into the atmosphere where it was either converted into OZONE or left to move around the rest of he atmosphere...

I HOPE THIS HELPS WITH YOUR WORK!

:D

An experiment is conducted in which the height of the ramp is changed and the speed of the skateboard down the ramp is measured. Which of the following correctly describes the speed of the skateboard down the ramp in this experiment?

Select one:
a. The manipulable (independent) variable
b. A constant
c. The responding (dependent) variable
d. A standard of comparison

Answers

Answer:

The responding (dependent) variable

Explanation:

In an experiment, one of the variables is either changed/maipulated or measured. The variable that is deliberately changed is called the INDEPENDENT VARIABLE while the variable that responds to the changes made to the independent variable, or is being measured is called DEPENDENT VARIABLE.

Hence, in the experiment involving the height of the ramp and the speed of the skateboard, the SPEED OF THE SKATEBOARD IS THE DEPENDENT/RESPONDING VARIABLE because it is the variable being measured.

During tubular secretion, fluid moves where:______.

Answers

Answer:

Renal tubular lumen

Explanation:

Tubular secretion is the process where fluid are moved are transfer from the peritubular capillaries to the renal tubular lumen of the kidney by the process of active transport and diffusion. It is the opposite of reabsorption and few substances are secreted in the nephron. Urine is left at reabsorption and secretion has taken place in the nephron.

List 4 different ways microorganisms affect our daily lives.

Answers

1. Boost our immune system
2. Protect us from auto immune diseases
3. Detoxify us and can fight off stress
4. Keep babies healthy

The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces)

Answers

Answer:

LVAAMQLLLLLFLLLFFLV

Explanation:

Transmembrane domains are hydrophobic regions inserted into the cell membrane, while surrounding protein regions are often designed to localize on opposite sides of the membrane. In general, hydrophobic amino acids are inserted into the hydrophobic core of the membrane. These hydrophobic residues have side-chains which are insoluble in water. Examples of hydrophobic amino acids, such as those observed in the putative hydrophobic transmembrane region, include leucine (L), valine (V), alanine (A), methionine (M) and phenylalanine (F).

Identify at least two limitations of Makennas model

Answers

Answer:Both legal and moral theorists have offered broadly “communicative” theories of criminal and moral responsibility.

Explanation:Mabey

What is the value of 6.74×106 when written in decimal form?

Answers

Answer:

714.44

Explanation:

First do 674x106 which is 71444. Then add in your decimal point which has two numbers after it so add it in the same spot from the right.

Answer:

0.063584906

Explanation:

Divide 6.74/ by 106= 0.063584906

Where did all the matter that made up the solar system come from?

Answers

Answer:

Our solar system formed about 4.5 billion years ago from a dense cloud of interstellar gas and dust. The cloud collapsed, possibly due to the shockwave of a nearby exploding star, called a supernova. When this dust cloud collapsed, it formed a solar nebula—a spinning, swirling disk of material.

Credits to: NASA

My Answer to it:

If we want to know how our solar system began, we would first look at how it all started, as in the universes and matter. This is tied into the Big Bang Theory, which is proposed by scientists the explains causes to why the universe formed. In the theory, it states that all of the current and past matter in the universe came into existence at the same time, roughly 13.8 billion years ago. At this time, all matter was compacted into a very small ball with infinite density and intense heat called a Singularity. As time went on, it started to expand and started to cool off to allow the formation of subatomic particles, and later simple atoms. Giant clouds of these primordial elements later coalesced through gravity to form stars and galaxies.


please helps .-.
which of these events had at LEAST effect on the history of life on earth?




A. Global climate change

B. Mountain building

C. Changes to the genetic code

D. Meteor or asteroid impacts​

Answers

the answer would be

B- mountain building

hope this helps have a good day :)
mountain building is correct .

Which of the following experimental treatments would NOT be a potentially effective strategy to inhibit or prevent cell-cell adhesion? Which of the following experimental treatments would NOT be a potentially effective strategy to inhibit or prevent cell-cell adhesion? removal of calcium ions from the extracellular space application of a protease that specifically destroys CAMs application of an antibody that inhibits the function of lectins adding an antagonist to prevent integrin function

Answers

Answer:

adding an antagonist to prevent integrin function

Explanation:

An antagonist is a drug capable of binding to a specific receptor, thus blocking the binding of endogenous ligand molecules. According to their mode of functioning, the antagonists are classified into four classes: chemical, physiological, competitive and non-competitive. Integrins are specific transmembrane receptors that facilitate cell adhesion. In consequence, in the case above indicated, the use of an antagonist for the integrin receptor will prevent cell adhesion.

what is the name of a process that produces use to make their own food

Answers

I think photosynthesis because that’s how plants make their food

Answer:

Photosynthesis

Explanation:

Photosynthesis. Plants are autotrophs, which means they produce their own food

I hope this helps.

Which of these is the same form of energy as light? Select the correct answer.
O A. Radio waves
OB. Sound waves
O C. Electricity
OD. Potential energy

Answers

A, radio waves. Radio waves are a part of the electromagnetic spectrum which also include microwaves, infrared light, visible light, ultraviolet light, x-rays and gamma rays

Psychology is considered as what
type of science?
A. Medical
B. Historical
C. Social

Answers

Answer:

social

Explanation:

hope this helps!

Organisms that belong to the same class must belong to the same:

Answers

Answer

The taxonomical classification of organisms follows this list of categories

Kingdom

Phylum

Class

Order

Family

Genus

Species

The number of organisms decrease from the top(Kingdom)to the bottom(Species).

Order Phylum is the answer

What are the adaptations of a wind pollinated flower? ​

Answers

The main adaptations of wind-pollinated plants are: The flowers are small inconspicuous, lacks fragrance and nectar. They are not attractive colors. The perianth lobes are reduced. The pollen grains are smooth, light, and dry. Usually bears unisexual flowers.

Who is the hottest girl in the world

Answers

Answer:

most definitely not you

Explanation:

everyone is equally beautiful.

Whoopi Goldberg is the hottest chick I have ever seen! Have you seen those eyebrows, cause I haven’t.

A scientist is conducting research to see whether dogs or cats are more popular. He goes to a dog park and asks all of the owners which pet they prefer. 100% of those polled stated that dogs are their favorite animal.

This experiment is an example of:
A) personal bias
B) experimental bias <<<<
C) cultural bias<<<<
D) a controlled experiment

PLEASE CHECK

Answers

Answer:

It is a controlled experiment. (D)

Explanation:

The reason why is because a scientist went to a dog park to conduct the experiment, there would be no cat owners there so obviously everyone would choose dogs because that is their pet. The scientist ran a controlled experiment.

What is the volume of the rectangular prism?

Answers

Answer:

270cm³

Explanation:

Volume of the rectangular prism: length * width * height.

In this case: 6cm * 9cm * 5cm

How do limiting factor determine the carrying capacity of an ecosystem

Answers

Answer:

Ecosystems only have so much food, water, space, and other resources. When different types of organisms all live in these areas, theres only so much that can go around.If an ecosystem has more organisms than its water supply can support then it is beyond its carrying capacity. The ecosystem will not be able to support the organisms and they will have to either relocate or die until the ecosystem is once again at or below carrying capacity.

The carrying capacity of an ecosystem is directly proportional to the limiting factors. Limiting factors increase, carrying capacity of an ecosystem increases.

What is Carrying capacity?

Carrying capacity may be defined as the maximum number of an individual that can be supported by a habitat. The carrying capacity of any habitat depends on the following two factors:

The food to eat.The space to live.

When limiting factors such as food, space, water, nutrients, etc. in a habitat increase, the carrying capacity of the habitat will definitely increase. This situation remains the same until there will be a scarcity in all those limiting factors suffered by a habitat.

When the limiting factors decline, the carrying capacity of the habitat ultimately lowers.

Therefore, it is well described above.

To learn more about Carrying capacity, refer to the link:

https://brainly.com/question/26660965

#SPJ6

Which of the following is a function of lipids in a cell?
They function in cell movement.
They are the components of cell membranes.
They form polysaccharides.
They produce enzymes.

Answers

Answer:

components of cell membranes

Answer:

b

Explanation:

Other Questions
What type of cells did Theodore Schwann study? You are on a rollercoaster going around a curve. Your speed is a constant 40 miles per hour. Are you accelerating? Why are there different Discs in Disc Golf? calculate the value of the expression 1, 284 How do you simplify Radicals?180v^4 The value of 2 5 2 is 100. TrueFalse QUESTION 10A bottle of vitamin water contains 3500 mg of potassium in 591.5g of H 20 What is the concentration of potassium by mass percent?085.5%O 5.92%O 0.59%O 16.9% how was the boston massacre used as propaganda by both the colonists and great britain?. where are the physics in football Started: Sep 10 at 2:13pmQuiz InstructionsComplete the following for your daily assignmenttionQuestion 2Solve:32x= 12 is 9 a digit of pie? Jessica was rock climbing. She was 42.8 feet above sea level. Jacob was swimming in the ocean below. He was 5.4 feet below sea level. How far apart were Jessica and Jacob?SHOW WORK or i'll just take your answer off. Which of the following substances is used up during photosynthesis? WHAT IS 123464 12? Choose the prepositions in the following sentence. More than one preposition may be in eachsentence.However, if you take it upon yourself to work hard and climb aboard the ship of accomplishment,you can use those formulas to solve problems. Question 10+10. If T is the midpoint of SU, find .r.8x + 1)121 - 1ST Thereflex causes anewborn to turn toward the source of anytouching that occurs around his mouth. The area of a square garden is 209 m squared. How long is the diagonal? Los AdjetivosUnlike English, in Spanish the adjectives must match the ______________________ and the _________________ of the nouns they describe.Adjectives Masculine FemenineEnding in o Singular--------------------------------------------------------------------------------------------------------- Plural --------------------------------------------------------------------------------------------------------- Ending in a Singular--------------------------------------------------------------------------------------------------------- Plural 1. Present ages of Asha and Amina are in the ratio 4:5. Eight year from now, the ratio of theirages will be 5:6. Find their present ages.