3
(7 x 8) * 10°= Idek

3(7 X 8) * 10= Idek

Answers

Answer 1

Answer:56000

Step-by-step explanation:


Related Questions

Solve the equation for X
4=6/ax+5

Answers

Answer:

x - 4 = 10 Solution.

2x - 4 = 10 Solution.

5x - 6 = 3x - 8 Solution

2(3x - 7) + 4 (3 x + 2) = 6 (5 x + 9 ) + 3 Solution.

Solution.

Step-by-step explanation:

The value of x in the given expression is -a/6

What is expression?

Expressions in math are mathematical statements that have a minimum of two terms containing numbers or variables, or both, connected by an operator in between.

Given is an expression, 4 = 6x / a + 5

Solving for x, we get,

4 = 6x / a + 5

Subtracting 5 both the side,

6x / a = -1

Multiplying by a both the sides,

6x = -a

Dividing by 6 both sides,

x = -a/6

Hence, the value of x is -a/6

For more references on expressions, click;

https://brainly.com/question/14083225

#SPJ2

Which information do you know is true from the diagram? Check all that apply.

∠ABD is a right angle.
Ray B C bisects angle ∠ABD.
m∠ABC = 45°
m∠CBD = 45°
m∠ABD = 90°

Answers

Answer:

a and e

Step-by-step explanation:

All the given option are true.

m∠ABC = 45° (true)

m∠CBD = 45° (true)

m∠ABD = 90° (true)

What is angle bisector ?

angle bisector is the line which divides the given angle into two equal parts.

Here, it is given that the angle [tex]\angle ABD[/tex] is a right angle triangle that is it will make an angle of 90 degree and the angle bisrector BC will divide the angle into two equal part that is  [tex]\angle ABC = \angle BCD = 45^{o}[/tex].

Therefore, all the given conditions are true.

Read more about angle bisector at:

https://brainly.com/question/12896755

#SPJ2

Convert 5 and 2/7 into a improper fraction.

Answers

Answer:

14 divide 5 =3.1 is your answer if I'm not wrong

Answer:

37/7

Step-by-step explanation:

First you multiply 5 by the denominator which is 7 which will equal to 35 and then you add the numerator which is 2 to that and you get 37/7

Find where the lines y =-3x + 2 and y = 5x 6 cross in the coordinate plane.

Answers

Answer:

(1, -1)

Step-by-step explanation:

Given lines

y = -3x + 2y = 5x - 6

They cross at:

-3x + 2 = 5x - 65x + 3x = 2 + 68x = 8x = 1

The y coordinate is:

y = -3*1 + 2 = -1

So the lines cross at point (1, -1)

Seven more than twice a number is 17

Answers

Answer:

2x + 7 = 17 using algebra equation you can resolve ir

100 pts, Easy question: 2 + (-4)

Answers

Answer:

2 + (-4) equals -2

Answer:

-2

Step-by-step explanation:

A positive number plus a negative number equals another negative number

What conclusion can be drawn by observing that 20 is to the right of 10 on a number line?

Answers

That 10 is a smaller number then 20


Identify the property used in each step of solving the inequality 3x – 2 > -4.
Step Justification
3x - 2-4 Given

3x > -2

X>-2/3

Answers

Answer:

2) is addition property

3) is multiplication property

Step-by-step explanation:

The addition property and division properties are used to solve the inequality.

What is Inequality?

A relationship between two expressions or values that are not equal to each other is called 'inequality.

The given inequality is  3x – 2 > -4.

Three times of x minus two is greater than minus four

By using addition property we add +2 on both the sides

3x – 2 +2 > -4+2

3x>-2

By using division property we divide  +3 on both the sides

x>-2/3

Hence, the addition property and division propertys are used to solve the inequality.

To learn more on Inequalities click:

https://brainly.com/question/28823603

#SPJ2

G(n)= -4n - 3
H(n)=3n+2
Find (g+h)(n)

Answers

Answer:

negative 1/3

Step-by-step explanation:

3n+2

3n= -2

n= -2/3

-4(-2/3) -3 = - 1/3

pls help asap!! Thank you! :D

Answers

the first blank is 10. second blank is 7. third blank is 63.

Explain why the function is discontinuous at the given number

Answers

Answer:

  left limit = 2 ≠ 1/2 = right limit

Step-by-step explanation:

A function is discontinuous if the limit of the function value approaching the point from the left is different than the limit approaching from the right.

Here, the left limit is 2 and the right limit is 1/2. The limits are different, which is why the function is discontinuous at x=-1.

Aaron bought 8 red flags for the parade. Large flags cost $20 each. Medium flags cost $12 each. Aaron spent $112 in all. How many large flags (L) and how many medium flags (M) did he buy?

Answers

Answer:

Step-by-step explanation:

Price assuming he bought all large flags: [tex]20*8=160[/tex]

Amount of money more: [tex]160-112=48[/tex]

Difference of price in both flags: [tex]20-12=8[/tex]

Medium Flags: [tex]48\div8=6[/tex]

Large Flags: [tex]8-6=2[/tex]

----------------------------------

The reason why this works, is because the amount of money more comes from the difference between both flags.

For a triangle, m<1 =75 and m<3 =40 what does m<2 =?​

Answers

Answer:

m<2 = 65

Step-by-step explanation:

The measures of angles 1 and 3 should be added together resulting in 115 degrees, and all triangles equal 180 degrees. Therefore, to find m<2, you have to subtract 115 from 180 resulting in a measure of 65 degrees.

If n(x)=4x-7, m(x) must be equal to which expression?

Answers

Step-by-step explanation:

the question is not understood plz clarify it

Answer:is 2 over 4|/x

Step-by-step explanation:

The sum of one-third a number and twenty-five is as much as twice the number

Answers

Answer:

The number is 15

Step-by-step explanation:

1/3(number) + 25 = 2(number)

subtract 1/3(number) from each side

25 = 2(number) - 1/3(number)

25 = 6/3(number) - 1/3(number)

25 = 5/3(number)

multiple each side by 3/5, which is the reciprocal of 5/3

25(3/5) = number

15 = number

Apples cost $2 per pound. Write an equation to represent how many pounds of apples you can buy for $20 ​

Answers

Answer:

10

Step-by-step explanation:

20/2=10

Answer:

10

Step-by-step explanation:

20÷2=10

twenty divided by two is ten

Solve the equation: 2/3y+5=7/3y-10

Answers

Answer:

y = 9

Step-by-step explanation:

2/3y + 5 = 7/3y - 10 ( Rearrange expression )

2/3y - 7/3y = -10 -5 ( Combine like terms )

-5/3y = -15 ( Divide )

y = 9

It’s should be the answer should be y=9

9x=25=13x-19=17y+5 solve for x and y

Answers

Combine like terms

X=-4
Y=17

whats the square root of 9

Answers

Answer:

the answer your looking for is 3

Step-by-step explanation:

8x+9-4x=25. I for real need help

Answers

8x+9-4x=25
4x+9=25
4x+9-9=25-9
4x=16
4x/4=16/4
X=4

Answer:

x=4

Step-by-step explanation:

8x+9-4x=25

8x-4x=4x (combined like terms)

4x+9=25

4x+9-9=25-9 (subtract 9 from both sides)

4x=16

4x/4=16/4

x=4

Hope this helps!

Pete ate 3/7 of a pizza if Pete ate 9 slides of the pizza how many slices were ther all together

Answers

Answer:

21 slices

Step-by-step explanation:

given:

3/7 of a pizza ----> represents 9 slices

hence,

1/7 of a pizza -------> represents 9/3 = 3 slices

therefore

a whole pizza

= 7/7 of a pizza -------> represents 3 x 7 = 21 slices

Answer:

Hi there!!

Your answer is:

21 slices

Step-by-step explanation:

3/7ths = 9 slices

× 7/3

1 whole pizza = 21 slices

This is called the multiplicative inverse! 3/7 × 7/3 = 1

Hope this helps!

One number is 3 times a first number. A third number is 100 more than the first number. If the sum of the three numbers is 510, find the numbers

Answers

Answer:

82

Step-by-step explanation:

solve a + (3a) + (a + 100)=510

What is the solution set for the inequality Negative one-fourthx2(x – 4)(x +5) ≤ 13?

Answers

Answer:

c

Step-by-step explanation:

Answer:

c

Step-by-step explanation:

What the answer to this math problem 6x-8=4(x+2)-7 ?

Answers

Answer:

x = 9/2

Step-by-step explanation:

6x - 8 = 4(x + 2) - 7

Distribute on the right side.

6x - 8 = 4x + 8 - 7

Combine like terms on the right side.

6x - 8 = 4x + 1

Add 8 to both sides. Subtract 4x from both sides.

2x = 9

Divide both sides by 2.

x = 9/2

When you add a positive and negative number, how can you tell whether the sum will be positive or Negative? ​

Answers

Answer:

just remember this:

negative x negative = positive

positive x positive = positive

postive x negative = negative

negative x postive= negative

lookon bbcbitesize for adding negatives and positive rule

14x-10=3 (4+x); solve for x

Answers

Answer:

x = 2

Step-by-step explanation:

So we are given the equation 14x - 10 = 3(4 + x) and we are asked to solve for x. To this, we will have to get x by itself on one side and a value on the other side.

14x - 10 = 3(4 + x)

Distribute the 3 on the right side.

14x - 10 = 12 + 3x

Add 10 to both sides.

14x = 22 + 3x

Subtract 3x from both sides.

11x = 22

Divide both sides by 11.

x = 2

So now we got the answer of x = 2.

I hope you find my answer helpful.

Answer:

x = 2

Step-by-step explanation:

14x - 10 = 3(4+x)

=> 14x -10 = 12 + 3x

=> 14x - 3x = 12 + 10

=> 11x = 22

=> x = 22/11

=> x = 2

If (8^9)p=8^18,what is the value of p? 20 points

Answers

Answer :

[tex]:\implies\sf\:(8^9)^p=8^{18}[/tex]

[tex]\dag\bf\:(a^m)^n=a^{mn}[/tex]

[tex]:\implies\sf8^{9p}=8^{18}[/tex]

[tex]\dag\bf\:18=9\times 2[/tex]

[tex]:\implies\sf\:8^{9p}=8^{9\times 2}[/tex]

[tex]\dag\bf\:a^x=a^y\:\longrightarrow\:x=y[/tex]

[tex]:\implies\sf\:9p=9\times 2[/tex]

[tex]:\implies\boxed{\bf{\red{p=2}}}[/tex]

Plss help will give brainliest

Answers

(-4,-2) is an Invalid pout and each component of the different quotient separately and plug the components into the difference quotient formula .

#1-7

10 points!!!!

please help :)

Answers

1. A
2. D
3. C
4. 5n
5. 24 ?
6. 80
7. 5

they may not be right i honestly dont know but hopefully it helps just a little :’)

use suitable Identities and find
●( X - 5 ) ( x-5 )
●( 3x +2 ) (3x -2 )
●( 1+x )(1+x) ​

Answers

Answer:

[tex].[/tex]

Step-by-step explanation:

IdEnTiTy UsED

[tex] {x}^{2} - {y}^{2} = (x + y)(x - y)[/tex]

1)

[tex](x - 5)(x - 5)[/tex]

=(x-5)²

2)

[tex](3x - 2)(3x + 2)[/tex]

[tex] {(3 x)}^{2} - {(2)}^{2} [/tex]

[tex] = 9 {x}^{2} - 4[/tex]

3)

[tex](1+x)(1+x)[/tex]

= (1+x)²

Other Questions
Michele bought 3.50 pounds of dried fruit for $11.55. Her friend buys 7.25 pounds of peanuts for $25.38. Which is less expensive per pound? By how much? What type of sequence is the following numbers? 2.5, 5, 10, ... a tint is obtained by mixing droplets of Assume that you are able to do an exhaustive search for the key to an encrypted message at the rate of 100 Million trials per second. How long in (days or years) would it take for you to find the key to a code that used a 112-bit key on average? What encryption algorithm might have been used by the encryption system? (Give the name of an encryption algorithm that uses 112-bit-key.) Amy cut 32 feet of chain into pieces that were each 14 ft long. How many of these pieces did Amy have after cutting the chain?Be sure to use the correct place value. Alicia had a checking account balance of -$11.00. She completed some chores to earn $44.50 and deposited it into her account. She decided to treat herself and a friend to go see a movie. Each ticket cost $6.25. How much money does she now have in her checking account?SHOW WORK or i'll just take ur answer off The temperature outside is 22 degrees C. What is this temperature in degrees Fahrenheit? Write hour answer as a decimal Which of Hidesatos traits is demonstrated in this excerpt and is characteristic of a folktale? my daughters homework is killing me short read Which is the solution set of: 5(x+3)10x>10? The legislative branch is..a.responsible for enforcing the lawb.divided into two seperate houses c.accountable for conducting trialsd.less powerful than the executive Which of the following verbs is reflexive?hablarcomervivirlevantarse Precision Manufacturing had the following operating results for 2014: sales = $38,900; cost of goods sold = $24,600; depreciation expense = $1,700; interest expense = $1,400; dividends paid = $1,000. At the beginning of the year, net fixed assets were $14,300, current assets were $8,700, and current liabilities were $6,600. At the end of the year, net fixed assets were $13,900, current assets were $9,200, and current liabilities were $7,400. The tax rate for 2014 was 34 percent. What is the cash flow from assets for 2014? State whether the following sentences are true or false regarding the nature of fiduciary-type funds and the accounting measurements within them. If the sentence is false, state why. a. Governments may access the resources of fiduciary funds to help support their own programs. b. When a government sponsors an Investment Trust Fund, the portion that belongs to other governments is reported as assets of the Fund, but the portion belonging to the sponsoring government is not. c. The statement of net position for a typical Agency Fund shows assets and liabilities, but no fund balance. d. When reporting on the resources of Pension Trust Funds, equity securities held by the Funds are reported at original cost. The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces) Which region in georgia is deepwater parts found in how does the author use of the word tusk inform the reader the angles of a qaudileteral are x,2x,100 and 110 degress find the value of 2x Helppppppppppppppppp Every weekday after tennis practice, Will buys either a carton of milk or a bottleof power drink.Suppose that m is the number of cartons of milk that Will purchased duringthe last month. His total cost for beverages in dollars last month can berepresented by the algebraic expression 2m + 3 (20 m).Which of the following statements are true? Select all that apply.The cost of the power drink is $3 per bottle,Will purchased 20 more bottles of power drink than cartons of milk.Will purchased a total of 20 beverages during the last month.The total amount Will spent on power drinks was $60An equivalent expression for the total cost of Will's beverages during this month is60 - m dollarsWill purchased 20 more cartons of milk than bottles of power drink