Plzzzz answer this quickly

Plzzzz Answer This Quickly

Answers

Answer 1

SORRY NOT POSITIVE BUT I THINK ITS

c


Related Questions

Why do you think more constitutional amendments have not been ratified?

Answers

Answer: The second proposed Amendment to never be ratified came about in 1810. ... The President's signature is considered unnecessary because of the constitutional provision that on the concurrence of two-thirds of both Houses of Congress the proposal shall be submitted to the States for ratification.

Explanation:The second proposed Amendment to never be ratified came about in 1810.

The second proposed Amendment is the constitutional amendments have not been ratified.

What is amendments?

The term "amendment" refers to the changes, recreation, and development of legislation. Citizens benefit from the addition of rights. The amendment to the constitution is the Bill of fundamental 10 rights. The amendment's goal is to inform citizens about what is right and wrong.

The second suggested Amendment that was never ratified occurred in 1810. Because the proposition is submitted to the states for ratification with the approval of two-thirds of both Houses of Congress, the President's signature is regarded unnecessary.

As a result, the second suggested Amendment is the constitutional amendments have not been ratified.

Learn more about on amendment, here:

https://brainly.com/question/12124635

#SPJ2

During Reconstruction, what was a belief of the Radical Republicans?

Answers

Answer:

The Radical Republicans believed blacks were entitled to the same political rights and opportunities as whites. They also believed that the Confederate leaders should be punished for their roles in the Civil War.

Explanation:

1. How does the size of the English population in 1600 compare to the size of the English population today?

Answers

Answer:

The size of the English population in 1600, compared to today, is much smaller.

Explanation:

Population growth, medicine, advances in technology

How did music help the slaves in Incidents in the Life of a Slave Girl?

Answers

Answer:

Music was a way for slaves to express their feelings whether it was sorrow, joy, inspiration or hope. Songs were passed down from generation to generation throughout slavery. These songs were influenced by African and religious traditions and would later form the basis for what is known as “Negro Spirituals”.

Explanation:

what are the six regions on a map

Answers

Answer:

1. African Region

2. Americas Region

3. South- East Asia Region

4.  European Region

5. Eastern Mediterranean Region

6. Western Pacific Region

The medieval Catholic Church had absolute including both spiritual and secular during the Middle Ages?

Answers

Power so brainliest?
The medieval catholic church had absolute power :)

Blacks and women had fewer rights after the English took control of New York from the Dutch.

Answers

Answer:

True

Explanation:

because Women use to just be able to stay home and talk care of the house hold and black were treated like slaves

After the English took over New York from the Dutch, it is TRUE that Blacks and Women had fewer rights.

Before the British took New York, it was under the authority of the Dutch and was called New Amsterdam. After the British took over, they proved to be quite conservative in that:

They reduced the rights of Black people and enslaved some They relegated women to mostly domestic duties

The British were quite conservative at the time on account of their version of Christianity. They were also just getting into the slave trade and so didn't see Blacks as worthy of rights.

In conclusion, the British takeover of New York meant that Blacks and Women lost many rights.

Find out more at https://brainly.com/question/17697445.

• Think of the United States as
a whole country. List three
industries or business you
think the United States is
known for.

Answers

Djjdjdejdjjdejdjfjdjd

Who was the first president of Texas ?

Answers

Answer:The 1836 Republic of Texas presidential election was the first such election in the newly established Republic of Texas. Popular war hero Samuel Houston was elected in a decisive victory over Henry Smith and Stephen F. Austin.

Explanation:

European nations founded settlements in North America in which order?
A. The Netherlands, England, France
B. Spain, The Netherlands, France
C. France, Spain, England
D. Spain, England, The Netherlands
SUBMIT

Answers

Answer:

Spain, England, The Netherlands

Explanation:

The prehistoric group of nomadic hunter, gatherers that used tools like the Clovis point.
•paleo
•archaic
•woodland
•mississippian​

Answers

Answer:

Paleo

Explanation:

The prehistoric group of nomadic hunter and gatherer used tools like the Clovis point were the Paleoindian. Clovis points date roughly from approximately 13,500 to 12,800 calendar years ago. Clovis Points were prehistoric tool made by native peoples of North America. The design of this tool had a resemble of a large spearhead, use as a weapon for hunting animals.

In American elections require a majority? Plurality? Explain

Answers

Answer:

The plurality system is the ... To win, a candidate need only poll more votes than any other single ... Election - Voters in polling station voting in 2012 Presidential Election, Ventura ... The problem of electoral representation hinges on the question of what is to be represented.

Explanation:

Below are our yearly learning focus & essential questions. * How do you see what we are studying now as a consequence of prior events and is there a relevance to today? * What essential significance supported by historical facts is important to explain this period of history? * How has the study of this period of history increased your civic responsibility and what is the personal impact on your life? * What are the cricitcal concepts from this period of history and what support conveys your understanding? * How can you prove the accuracy (reliability) of sources about this time period? * Is there any evidence from this period to support the concept that "history repeats itself?" * How has this study increased your global awareness of your world today and what are the connections? After reading this questions, please write a statement that acknowledges that you have read these questions.

Answers

Answer:all u can dooo

Explanation:

What is job specialization in the ancient world?

Answers

Job specialization in the Ancient world is splitting up the work process and giving the responsibility of each chunck of work to different individuals or groups. For example; people who specialize in making iron weapons and shields and those who specialize in making baked goods.

Fertile Crescent Rainfall What does the map show about climate? Choose three answers. Black Sea Most rain falls north of the Fertile Crescent Caspian Sea The Tigris and Euphrates River areas receive no rainfall. Fertile Crescent Tigris River The land below the Fertile Crescent is dry. Mediterranean Sea Zagros Mountains The coast of the Red Sea receives 600 mm rainfall annually. Euphrates River The Fertile Crescent receives some rain. ​

Answers

Answer:

a,c,e

Explanation:

What are two reasons this author gives for why American
colonists should be loyal to England? Provide a quote to support your answer.

Answers

Some colonists who were not persuaded by the political struggle joined the British for personal gain or military glory. Some joined out of sheer loyalty to the Crown — they still believed themselves loyal British citizens. There were also many American farmers willing to sell their goods to the British for profit.

Read the list of accusations made against King George III. Was he guilty of the charges? Was parliament guilty?

Answers

Answer:

What is the Declaration of Independence accusing King George III of doing? The full statement is: "The history of the present King of Great Britain is a history of repeated injuries and usurpations, all having in direct object the establishment of an absolute Tyranny over these States.

Explanation:

what colony was founded to provide a second chance to English debtors?​

Answers

Georgia

Explanation:

Georgia was the colony that got founded to provide a second chance to English debtors.

In Great Britain at this time, many of the prisons were being overcrowded by people who were in debt. There soon wasn't enough room for people who were committing more serious crimes, which caused England to try to find a solution.

Georgia was named after King George II and was used as a second chance for many of the English debtors that took up space in British prisons. Not only this, but Georgia would serve as protection for other colonies like South Carolina from the French and Spanish, as they would have to pass through the colonists in Georgia first.

Answer:

Georgia

Explanation:

James Oglethorpe established Georgia as a way for debtors to have a second chance at a successful life.

Islam and Christianity have many things in common. Which of the following is NOT a shared attribute of these two faiths?

Jesus is a prophet
they both descend from Abraham
monotheism
dramatic art and architecture

Answers

Answer:

Jesus is a prophet

Explanation:

the major thing about Christianity is Jesus was not a prophet but the Son of God.

Answer:

Jesus is a prophet.

Explanation:

Islam and Christianity have many things in common, one of the things that they do not have in common is Jesus being a prophet, because Jesus never was a prophet, but instead the son of god.

The geographic and climate differences between the northern and southern British colonies resulted in which of the following:
long lifespan and agriculture in the south
long lifespan and family farms in the north
short lifespan and agriculture in the north
short lifespan and family farm in the south

Answers

Answer:

Long lifespan and agriculture in the South

Explanation:

I think the answer is Long lifespan and agriculture in the South. Hope this helps!

PLZ FAST

"... (A)ll men are by nature equally free and independent, and have certain inherent rights... namely, the enjoyment of life and liberty, with the means of acquiring (getting) and possessing property...."
- The Virginia Declaration of Rights, 1776
This quote would later influence the creation of what document?

A) Common Sense
B) The U.S. Constitution
C) Poor Richard's Almanac
D) The Declaration of Independence

Answers

Answer:

D) The Declaration of Independence

Answer: ITS D

Explanation: HOPE IT HELPS

which list puts the event leading to the development of civilizations in the correct order?

(middle school)

Answers

Answer:

The ancient civilization known to men were the Sumerians. Modern history dates the establishment of the Sumerians approximately 5000 BC. They settled in the middle of the Tigris and Euphrates River, in the Middle East region of what today is Iraq. They founded powerful city-states such as Uruk, Ur, Eridu, Nippur, Kish, and Lagash.

Then, the ancient Egypt civilization. They settled in the banks of the Nile River in North Africa. Historians debate on its origin but some agree that it was approximately 3500 to 3000 BC.

The Indus Valley civlization settled in the northwest part of South Asia, next to the Indus River, almost 3000 to 2500 BC.

why did plantation owners prefer white servants and african slaves to American Indian owners?

Answers

Answer:

somebody pls answer this cuz i need it too

Explanation:

please help me, will give brainliest out

Answers

✅The Columbian Exchange: goods introduced by Europe, produced in New World. As Europeans traversed the Atlantic, they brought with them plants, animals, and diseases that changed lives and landscapes on both sides of the ocean.◽

IamSugarBee

What are Cato's letters??? Please answer as quicka s you can!?

Answers

It’s a collection of newspaper articles

Answer:

Cato's Letters were essays by British writers John Trenchard and Thomas Gordon, first published from 1720 to 1723 under the pseudonym of Cato, the implacable foe of Julius Caesar and a famously stalwart champion of republican principles.

Explanation:

What are the Pros of dictorship

Answers

Answer:

With Dictatorship government corruption can be removed immediately, Dictatorships provide more stability, crime levels in society decrease, government resources can be sent out more quickly and efficient, and innovation can be promoted.

How did the ideas of the Enlightenment help inspire the Declaration of Independence?

Answers

Answer:

Enlightenment Influence on America

In the Declaration, Jefferson made references to the beliefs of the Enlightenment philosopher John Locke. In perhaps the most famous line of the Declaration, Jefferson stated protection of natural rights "life, liberty, and the pursuit of happiness".

Explanation:

Answer:John Locke's support for the principle of popular sovernty

Explanation: jefferson said so

what ways/reasons did the pope use to motivate Christians to
join the Crusade?

Answers

Answer:

The pope motivated the christians to join his crusade by saying they needed to reclaim the holy land from the Muslims

Explanation:

giving rise to the Crusades by calling all Christians in Europe to war against Muslims in order to reclaim the Holy Land, with a cry of "Deus volt!" or "God wills it!" this also shows that he used the christians beliefs to claim the "holy land"

He called upon the Crusades by bringing Christians in Europe to war against Muslims to reclaim the Holy Land

Which statement best describes the experience of the Israelites under Babylonian rule?
Israelites learned Babylonian customs and blended them with their own.
Israelites thrived under Babylonian rule and created a brand-new culture.
Israelites suffered greatly, having been taken captive or exiled from their homes.
Israelites lost their faith and began to follow Babylonian religious customs.

Answers

Answer:

Israelites suffered greatly, having been taken captive or exiled from their homes.

Explanation:

The phrase "Israelites suffered greatly, having been taken captive or exiled from their homes" sums up the Israelites' experience living under Babylonian rule the best. Option C is correct.

What role did the Babylonian Empire play?

Under the Amorite monarch Hammurabi, who reigned from 1792 to 1750 B.C., Babylon rose to prominence as a military force. After capturing nearby city-states, Hammurabi united most of southern and central Mesopotamia under his control, founding the Babylonian empire.

The Babylonian and Neo-Babylonian Empires both had Babylon as their capital. It was a vast city, densely populated, with high walls, and many palaces and temples.

Wonderful treasures were left behind by ancient Babylonia. The Babylonians built an empire that gave the world, among other things, codified laws, a tower that towered above the earth, and one of the Seven Wonders of the World. They used the innovations of the Sumerians and added to them.

Therefore, option C is correct.

Learn more about the Babylonian rule, refer to:

https://brainly.com/question/19052791

#SPJ5

The Founders created a federal system of government because they

Answers

The Framers chose federalism as a way of government because they believed that governmental power inevitably posesa threat to the individual liberty. In their attempt to balance order with liberty, the Founders identified several reasons for creating a federalist government. For reasons
Other Questions
What is impossible for a machine to do? A. do a greater amount of work than the amount of work done on the machine B. apply a force in a direction that is different than the direction of the force applied to the machine C. move an object a greater distance than the distance that part of the machine was moved D. apply a force that is less than the force that is applied to the machine When economists measure a countrys development, the most important factor they study is its __________. are molecules bigger than cells in the human body? and this is for science Michele bought 3.50 pounds of dried fruit for $11.55. Her friend buys 7.25 pounds of peanuts for $25.38. Which is less expensive per pound? By how much? What type of sequence is the following numbers? 2.5, 5, 10, ... a tint is obtained by mixing droplets of Assume that you are able to do an exhaustive search for the key to an encrypted message at the rate of 100 Million trials per second. How long in (days or years) would it take for you to find the key to a code that used a 112-bit key on average? What encryption algorithm might have been used by the encryption system? (Give the name of an encryption algorithm that uses 112-bit-key.) Amy cut 32 feet of chain into pieces that were each 14 ft long. How many of these pieces did Amy have after cutting the chain?Be sure to use the correct place value. Alicia had a checking account balance of -$11.00. She completed some chores to earn $44.50 and deposited it into her account. She decided to treat herself and a friend to go see a movie. Each ticket cost $6.25. How much money does she now have in her checking account?SHOW WORK or i'll just take ur answer off The temperature outside is 22 degrees C. What is this temperature in degrees Fahrenheit? Write hour answer as a decimal Which of Hidesatos traits is demonstrated in this excerpt and is characteristic of a folktale? my daughters homework is killing me short read Which is the solution set of: 5(x+3)10x>10? The legislative branch is..a.responsible for enforcing the lawb.divided into two seperate houses c.accountable for conducting trialsd.less powerful than the executive Which of the following verbs is reflexive?hablarcomervivirlevantarse Precision Manufacturing had the following operating results for 2014: sales = $38,900; cost of goods sold = $24,600; depreciation expense = $1,700; interest expense = $1,400; dividends paid = $1,000. At the beginning of the year, net fixed assets were $14,300, current assets were $8,700, and current liabilities were $6,600. At the end of the year, net fixed assets were $13,900, current assets were $9,200, and current liabilities were $7,400. The tax rate for 2014 was 34 percent. What is the cash flow from assets for 2014? State whether the following sentences are true or false regarding the nature of fiduciary-type funds and the accounting measurements within them. If the sentence is false, state why. a. Governments may access the resources of fiduciary funds to help support their own programs. b. When a government sponsors an Investment Trust Fund, the portion that belongs to other governments is reported as assets of the Fund, but the portion belonging to the sponsoring government is not. c. The statement of net position for a typical Agency Fund shows assets and liabilities, but no fund balance. d. When reporting on the resources of Pension Trust Funds, equity securities held by the Funds are reported at original cost. The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces) Which region in georgia is deepwater parts found in how does the author use of the word tusk inform the reader