Question 1 2 pts This question is worth 2 points. Using the ruler included below, how long are these crucible tongs? ​

Question 1 2 Pts This Question Is Worth 2 Points. Using The Ruler Included Below, How Long Are These

Answers

Answer 1
The crucible tongs are 8.3 inches long.

Related Questions

Arrange these elements according to first ionization energy.
highest to lowest ionization energy
Li
N
Be
C
B
F
O
Ne

Answers

Answer:

please find the attached file.

Explanation:

In the attachment file, we define the order of the ionization of the energy.  

As its components are seen, their energy of ionization rises and falls further.  Nitrogen and oxygen were detected as an anomaly. Nitrogen has more IE than oxygen because Nitrogen has the [tex]2p^3[/tex] configuration to Is half-filled  It's got bigger IE than B. As, be making the 2s2 configuration fully disc.

Arrangement of elements according to first ionization energy from

highest to lowest ionization energy are Ne>F>O>N>C>B>Be.

Neon, a noble gas with a fully filled electron shell, has the highest ionisation energy of the substances on this list, making it the most stable and least likely to lose an electron. Fluorine has the second-highest ionisation energy, after helium. Due to its strong electron attraction, it is a highly electronegative element, making it more challenging to remove an electron from its outer shell. The ionisation energy of oxygen is third highest. Additionally, it has a high electronegativity and expels an electron with a lot of energy.

The fourth-highest ionisation energy is that of nitrogen, abbreviated as N. In terms of electronegativity, it is comparable to oxygen and requires a lot of energy to remove one electron. Carbon has the fifth-highest ionisation energy, after hydrogen and helium. An enormous amount of energy is needed to take an electron out of its outer shell. The second-lowest ionisation energy on this list belongs to borax, abbreviated as B. Compared to the other elements, boron is simpler to remove an electron from. Beryllium, symbol Be, has the lowest ionisation energy of all the elements on this list. From among these elements, an electron can be taken out the simplest.

To know more about ionization energy, here:

https://brainly.com/question/33907239

#SPJ6

Which of the following additions to alkenes occur(s) specifically in an syn fashion?
A) dihydroxylation using Os04, H202
B) addition of H2
C) hydroboration
D) addition of HCI
E) A, B, and C

Answers

Answer:

E) A, B, and C

Explanation:

Syn addition refers to the addition of two substituents on the same face or side of a double bond. This differed from anti addition which a occurs across opposite face of the double bond.

Hydrogenation, hydroboration and dihydroxylation all involve syn addition to the double bond, hence the answer chosen above.

Dihydroxylation using Os04, H202, Addition of H2 and Hydroboration to

alkenes occur in a syn fashion.

Syn addition refers to the addition of two substituents( compounds) on the

same side thereby increasing the number of substituents and a decrease in

the bond order.

Hydrogenation, hydroboration and dihydroxylation all undergo syn addition which is the addition of the substituent to the same side which is why it is the right choice.

Read more on https://brainly.com/question/17462452

I need help answering these Significant Figures - precise measurements questions

1) 0.00030 = ______ 2) 3.3 x 108 = ______ 3) 1000 = ______

4) 3.50 x 107 = ______ 5) 2.100 x 10-1 = ______ 6) 1101 = ______

7) 0.043 = ______ 8) 0.09730 = ______ 9) 2010 = ______

10) 3060 = ______ 11) 43.8 = ______ 12) 0.00810 = ______

13) 5.0 x 10-4 = ______ 14) 8.570 x 10-8 = ______ 15) 7.500 x 103 = ______


Add/ Subtract Sig Fig: Solve and Round accordingly.

1) 2.6391 + 34.3124 + 1.22 = _______ 8) 94.1 + 5.7 = _______

2) 3.9 + 9.7113 + 38.9223 = _______ 9) 81.29 - 75.7 = _______

3) 9.9 + 77.1135 + 2.226 = _______ 10) 61.741 + 6.632 = _______

4) 7.8 + 17.2 = _______ 11) 6.1 + 28.2 + 94.229 = _______

5) 6.219 - 2.9 = _______ 12) 8.1732 - 1.933 = _______

6) 9.8 + 27.771 = _______ 13) 81.87 + 3.37 + 4.8421 = _______

7) 4.48 + 7.2155 + 13.9 = _______ 14) 17.56 - 6.4929 = _______


Multiply/Divide Sig Fig: Solve and round accordingly

1) 0.005 x 81.327 x 1000 = __________ 9) 0.0027 x 1.554 x 3090 = __________

2) 5 x 268 = __________ 10) 38.245 x 0.0069 = __________

3) 565 x 0.0054 x 4040 = __________ 11) 89.0 x 19.13 x 8400 = __________

4) 100 ÷ 2.0 = __________ 12) 208 ÷ 7.6 = __________

5) 4 x 23 = __________ 13) 34 x 800 = __________

6) 5006 ÷ 5.979 = __________ 14) 204 ÷ 92.731 = __________

7) 80 ÷ 8.1 = __________ 15) 300 ÷ 98.434 = __________

8) 0.4 x 0.003 x 2400 = __________ 16) 0.031 x 0.007 x 100 =

Answers

Answer:

[tex]3.0 x {10}^{4} [/tex]

Q1. Briefly explain why the Zeff experienced by a valence electron in Cl is larger than in Mg. Q2. Briefly explain why the Zeff difference described in Q1 explains why the radius of Cl is smaller than the radius of Mg. Q3. Briefly explain, in terms of the principal quantum number (n), why the radius of Ba is larger than the radius of Mg.

Answers

Answer:

See explanation

Explanation:

Q1:

Chlorine has 17 protons while magnesium has only 12 protons. Recall that the Zeff depends on the size of the nuclear charge. The greater the size of the nuclear charge, the larger the Zeff experienced by a valence electron.

Q2:

The larger the Zeff, the smaller the atomic radius. Since the valence electrons of Cl experience a greater Zeff than those of Mg due to greater size of the nuclear charge, the atomic radius of chlorine will be smaller than that of Mg.

Q3:

The radius of an atom increases as the value of the principal quantum number (n) increases down the group due to addition of more shells. The greater the number of shells added, the greater the principal quantum number (n) and the greater the atomic radius, hence the answer.

The electrode that contains the item to be electroplated

a) anode
b)cathode

Answers

The answer is A, anode

The electrode that contains the item to be electroplated is a cathode. The correct option is B.

What are electrodes?

Electrodes are a source of conductance of electron and behaves as a conducting material for the current too it is of two types mostly the cathode and the anode.

The anode is responsible for oxidation mostly called oxidation half cell and releases the electron while the cathode is responsible for the gain of electrons and deposition of the material as electroplated and called reduction half cell.

Therefore cathode is an electrode that contains the item to be electroplated. Option B is correct.

Learn more about electrodes, here:

https://brainly.com/question/17060277

#SPJ6

Bromine gas in a container is heated over a flame. What happens to the average kinetic energy of the bromine
particles?
Olt decreases rapidly.
It increases quickly.
O It remains the same.
O It decreases slowly.

Answers

Answer:

The answer is b

Explanation:

I got my answer off of quizlet

Answer:

B) It increases quickly.

Explanation:

Edg 2020

11. A 100% silver ring would be an example of a
a) Pure substance
b) Mixture
c) Really nice gift
d) Compound

Answers

Answer:

a pure substance or a compound

Answer:

a pure substance

Explanation:

Any substance made from a single material is pure. Silver is an element just like all the others listed on the periodic table, so a block of silver is pure.

Determine the number of water molecules in 115g of chromium(III) oxalate trihydrate.

Answers

Answer:

[tex]4.92x10^{23}molecules H_2O[/tex]

Explanation:

Hello,

In this case, since the chromium(III) oxalate trihydrate is Cr₂(C₂O₄)₃ ·3H₂O whose molar mass is 422 g/mol and one mole of chromium(III) oxalate trihydrate contains three moles of water, by also considering that one mole of substance contains the Avogadro´s number in particles, the number of water molecules turns out:

[tex]=115gCr_2(C_2O_4)_3\ 3H_2O*\frac{1molCr_2(C_2O_4)_3\ 3H_2O}{422gCr_2(C_2O_4)_3\ 3H_2O}*\frac{3molH_2O}{1molCr_2(C_2O_4)_3\ 3H_2O} *\frac{6.022x10^{23}molecules H_2O}{1molH_2O} \\\\=4.92x10^{23}molecules H_2O[/tex]

Best regards.

1. A homogeneous mixture of 2 or more metals is called an
a. alloy
C. covalent bond
b. anion
d. chemical bond

Answers

it will be alloy. alloy is two or more metals mixed together

Suppose that a substance in a beaker is heated over a burner in a science lab. Which observation would most likely indicate that a chemical change has occurred in the substance?

If the substance is a liquid or solid, an increase in temperature would indicate a chemical change.
If the substance is a liquid, a change of some of the liquid to gaseous form would indicate a chemical change.
If the substance is a solid, a change of some of the solid to liquid form would indicate a chemical change.
If the substance is a liquid or solid, production of an odor would indicate a chemical change.

Answers

Answer:

its D

Explanation:

Answer:

D

Explanation:

How many unpaid electrons are in 1s2 2s2 2p6 3s2 3p6

Answers

Answer:

No unpaired electrons

Explanation:

This is because it is diamagnetic. Hope that helps:)

Answer:

As we can see, the first shell has its 2 electrons

the second shell has its 8 electrons

we know that the third shell also needs 8 electrons and we can see that the third shell also has 8 electrons.

Therefore, all the shells of this atom are filled and this atom is stable

So we can say that there are no unpaired electrons

Kindly mark Brainliest, thanks

A high protein diet contains 70.0g of carbohydrates, 5.0g of Fat, and 150g of protein. How much energy, in kilocalories, and kilojoules, does each diet provide? Round answers off to tens place

Answers

Answer:

925kcal, 3870.2kJ.

Explanation:

The calorie densities of these energy sources are:

Carbohydrates: 4kcal/g

Fat: 9kcal/g

Protein: 4kcal/g

70.0g of carbohydrates are:70.0g * (4kcal/g) = 280kcal

5.0g fat * (9kcal/g) = 45kcal

150g protein * (4kcal/g) = 600kcal

The energy in kilocalories is 600+280+45 = 925kcal

As 1kcal is 4.184kJ. 925kcal are:

925kcal * (4.184kJ/1kcal) = 3870.2kJ

In a galvanic cell:______.a. reduction occurs at the (name of electrode) _____________b. the anode is the (sign) electrode anions flow in solution toward the (name of electrode)__________ ___________ electrons flow from the (name of electrode) to (name of electrode) ________ _______

Answers

Answer:

In a galvanic cell:

a. reduction occurs at the cathode.

b. the anode is the (-) electrode. Anions flow in solution toward the anode. Electrons flow from the anode to the cathode.

Explanation:

The experimental apparatus for generating electricity through the use of a spontaneous reaction is called a galvanic cell or voltaic cell.

By definition, the anode in a galvanic cell is the electrode at which oxidation occurs and the cathode is the electrode at which reduction occurs.

To complete the electrical circuit, the solutions must be connected by a conducting medium through which the cations and anions can move from one electrode compartment to the other. This requirement is satisfied by a salt bridge, which, in its simplest form, is an inverted U tube containing an inert electrolyte solution, such as KCl or NH₄NO₃, whose ions will not react with other ions in solution or with the electrodes.

During the course of the overall redox reaction, electrons flow externally from the anode through the wire to the cathode. In the solution, the cations move toward the cathode, while the anions move toward the anode.

An electric current flows from the anode to the cathode because there is a difference in electrical potential energy between the electrodes.

A common example of a galvanic cell is the Daniell cell, with Zn and Cu electrodes and  ZnSO₄ and CuSO₄ solutions.

Use the density formula to solve the following problems. A sample of a substance has a volume of 60.5 mL and a density of 1.20 g/mL. What is the mass of the sample?Use the density formula to solve the following problems.

Answers

Answer:

72.6 g

Explanation:

Step 1: Given data

Volume of the substance (V): 60.5 mLDensity of the substance (ρ): 1.20 g/mLMass of the substance (m): ?

Step 2: Calculate the mass of the substance

The density of a substance is equañ to its mass divided by its volume. The density formula is:

ρ = m/V

m = ρ × V

m = 1.20 g/mL × 60.5 mL

m = 72.6 g

If the mass of a helicopter is 4500 kg and the net force on it is 18000 n, what is the helicopters acceleration

Answers

Answer:

The answer is

4 m/s²

Explanation:

The force of an object can be found by using the formula

F = m × a

where

m is the mass

a is the acceleration

F is the force

Since we are finding the acceleration

[tex]a = \frac{F}{m} [/tex]

From the question

F = 18000 N

m = 4500 kg

Substitute the values into the above formula and solve

That's

[tex]a = \frac{18000}{4500} \\ = \frac{180}{45} [/tex]

We have the final answer as

4 m/s²

Hope this helps you

Draw the products formed when 2−propanol [(CH3)2CHOH], the main ingredient of rubbing alcohol, is treated with H2SO4.

Answers

Answer:

Explanation:

Elimination reaction occurs when 2−propanol [(CH3)2CHOH] is treated with H2SO4, this is because the H2SO4 is a dehydrating agent. With concentrated tetraoxosulphate (VI) acid at 180°C, 2 - propanol reacts to form a conjugate acid and a conjugate base.

The reaction formation and the products can be seen in the attached image below.

i need help simplifying 4+7(x+3)​

Answers

Answer:

7x+25

Explanation:

What are some examples of matter?

Answers

Answer:

An apple.

A person.

A table.

Air.

Water.

A computer.

Paper.

Iron.

Hope this helps you

Answer:

your boddy is made of mater and a clock too it is still a mater of time.

Explanation:

 

what element does this Bohr show ?

Answers

This has four neutrons and three protons. Additionally, it has three electrons in the electron cloud. A elements number of neutrons will also be an elements atomic number on the periodic table. So, this means that the Bohr model is representing the element Lithium.


Hope this helps :)

The table below shows some information about four different elements.

Element

Classification

Density (g/cm³)

barium (Ba)

metal

3.6

beryllium (Be)

metal

1.8

chromium Cr)

metal

7.2

phosphorus P)

nonmetal

1.8



A cube of an unknown element has a shiny, silvery color. The side of the cube measures 2.0 cm and the cube has a mass of 14.56 g.



Based on the information in the table, which element makes up the cube?

Answers

Answer:beryllium

Explanation:

what are limitations of an egg without the shell but has a very thin layer holding it all together

Answers

Answer:

As a hen ages, the eggs that she lays get gradually larger. However, the calcium content deposited in the shell remains the same despite the size of the egg. So the eggshells become thinner as the hen ages.

Explanation:

Ice Select one: a. is a crystal of water molecules packed in an open structure stabilized by hydrogen bonds. b. is less dense than liquid water. c. contains 17% more hydrogen bonds then water. d. all of the statements above are true. e. none of the statements above are true.

Answers

Answer:

All of the statements above are true.

Explanation:

Ice is solid water. Ice consists of an array of water molecules arranged into a crystal lattice. Ice has spaces between the water molecules so it is less dense than liquid water. Ice is about 9% less dense than liquid water. This accounts for the fact that it floats on water.

Ice contains more hydrogen bonds per water molecule when compared to liquid water.

Calculate the mass of a piece of metal if its volume is 2.3cm^3 and density is .486g/cm^3​

Answers

Answer:

  1.1178 g

Explanation:

The product of volume and density is mass:

  (2.3 cm^3)(0.486 g/cm^3) = 1.1178 g

_____

It would be a very unusual piece of metal that would float higher in water than most kinds of wood. The given "metal" at (0.486) has less than 3/4 the density of birch (at 0.67), which is a pretty light wood.

Calcium reacts with water to produce hydrogen and slightly soluble calcium
hydroxide, Ca(OH)2.
Ca(s) + 2 H20(1) --> Ca(OH)2(aq/s) + H2(g).
What will be the volume of hydrogen produced at 27°C and 7.00 x 102 torr when 25
g of calcium and 25 g of water react?

Answers

Answer:

[tex]V=16.65L[/tex]

Explanation:

Hello,

In this case, considering that both 25 g of calcium and water react, the first step is to identify the limiting reactant by considering the yielded moles of hydrogen for the same amount of reactant as follows:

[tex]n_{H_2}^{from\ Ca}=25gCa*\frac{1molCa}{40.1gCa}*\frac{1molH_2}{1molCa} =0.623molH_2\\\\n_{H_2}^{from\ H_2O}=25gH_2O*\frac{1molH_2O}{18gH_2O}*\frac{1molH_2}{2molH_2O}=0.694molH_2[/tex]

Thus, since calcium yields a smaller amount of hydrogen, it is the limiting reactant so 0.623 moles of hydrogen are yielded. In such a way, by using the ideal gas equation one finds the volume as follows:

[tex]V=\frac{nRT}{P}=\frac{0.623mol*0.082\frac{atm*L}{mol*K}*300K}{700torr*\frac{1atm}{760 torr} } \\ \\V=16.65L[/tex]

Best regards.

Explain why mass cannot be used as a property to identify a sample of matter.

Answers

Mass cannot be used as a property to identidy a sample of matter because it is an extensive property which depends on the amount of matter in a sample, not the tupe of matter it is.

Mass is an extensive property hence it cannot be used as a property to identify a sample of matter.

The properties of matter can generally be classed into two categories;

Intensive propertiesExtensive properties

Intensive properties of matter are those properties of matter that do not depend of the amount of matter present. In other words, they are characteristic of a particular kind of matter. Examples of such properties include, density, boiling point, etc.

Extensive properties depend on the amount of matter present. They include; mass, weight, etc.

Intensive properties serve as a sort of fingerprint that identifies a substance.

Extensive properties such as mass only measure the amount of matter in a sample and can not be used to identify a sample of matter.

Learn more: https://brainly.com/question/17889594

Some enzymes have one or more sulfhydryl (thiol) groups that are important to enzymatic activity but that can react upon standing in solution to form inactive disulfide bonds.
Thiol reagents, such as 1,4-dithiothreitol (DTT), are often added to the solutions of such proteins to protect them from this reaction and to reverse it when it occurs. (The reverse reaction works best at slightly alkaline pH.) Draw the product formed when DTT reacts with a protein disulfide bond to liberate the free thiol groups. Which of the following occurs in this reaction? A. The protein disulfide is oxidized.
B. The protein disulfide is reduced.
C. DTT is reduced.
D. DTT is oxidized.

Answers

Answer:

A. Protein disulfide is oxidized.

Explanation:

When thiol reagents are introduced with some protein solutions they react with molecules of disulfide and oxidize the protein. There occurs inter-conversion of thiol molecules into free disulfide molecules. The DTT reduces the disulfide molecules bonds of proteins and it starts to peptide.

Which element has a gas notation of [Kr]5s2 4d7

Answers

i think it would be Kriptonite

How do an independent variable and a dependent variable differ in a scientific investigation?

Answers

Answer:

stop cheating and be smart

Explanation:

ugh sjdjdkxkdkdkdkdkdkdahahahajajaja

What isotope has 18 protons and 22 neutrons?

Answers

Answer:

Argon.

Explanation:

Argon is the element having 18 protons and 22 neutrons present in its nucleus. so its atomic number is 18 and mass number is 40 if we added both number of protons and neurons. Argon belongs to noble family due to completion of outermost shell and non reactive nature. It is the third most abundant gas about 0.934% present on the earth after nitrogen and oxygen.

10. A small gold nugget has volume of 0.87 cm3. What is its mass if the density of gold is 19.3 g/cm3?

Answers

Answer:

16.791 grams

Explanation:

The density formula is:

[tex]d=\frac{m}{v}[/tex]

Rearrange the formula for m, the mass. Multiply both sides of the equation by v.

[tex]d*v=\frac{m}{v}*v[/tex]

[tex]d*v=m[/tex]

The mass of the gold nugget can be found by multiplying the density and volume. The density is 19.3 grams per cubic centimeter and the volume is 0.87 cubic centimeters.

[tex]d= 19.3 g/cm^3\\v-0.87 cm^3[/tex]

Substitute the values into the formula.

[tex]m=d*v[/tex]

[tex]m= 19.3 g/cm^3*0.87 cm^3[/tex]

Multiply. Note that the cubic centimeters, or cm³ will cancel each other out.

[tex]m=19.3 g*0.87[/tex]

[tex]m=16.791 g[/tex]

The mass of the gold nugget is 16.791 grams.

Other Questions
Alicia had a checking account balance of -$11.00. She completed some chores to earn $44.50 and deposited it into her account. She decided to treat herself and a friend to go see a movie. Each ticket cost $6.25. How much money does she now have in her checking account?SHOW WORK or i'll just take ur answer off The temperature outside is 22 degrees C. What is this temperature in degrees Fahrenheit? Write hour answer as a decimal Which of Hidesatos traits is demonstrated in this excerpt and is characteristic of a folktale? my daughters homework is killing me short read Which is the solution set of: 5(x+3)10x>10? The legislative branch is..a.responsible for enforcing the lawb.divided into two seperate houses c.accountable for conducting trialsd.less powerful than the executive Which of the following verbs is reflexive?hablarcomervivirlevantarse Precision Manufacturing had the following operating results for 2014: sales = $38,900; cost of goods sold = $24,600; depreciation expense = $1,700; interest expense = $1,400; dividends paid = $1,000. At the beginning of the year, net fixed assets were $14,300, current assets were $8,700, and current liabilities were $6,600. At the end of the year, net fixed assets were $13,900, current assets were $9,200, and current liabilities were $7,400. The tax rate for 2014 was 34 percent. What is the cash flow from assets for 2014? State whether the following sentences are true or false regarding the nature of fiduciary-type funds and the accounting measurements within them. If the sentence is false, state why. a. Governments may access the resources of fiduciary funds to help support their own programs. b. When a government sponsors an Investment Trust Fund, the portion that belongs to other governments is reported as assets of the Fund, but the portion belonging to the sponsoring government is not. c. The statement of net position for a typical Agency Fund shows assets and liabilities, but no fund balance. d. When reporting on the resources of Pension Trust Funds, equity securities held by the Funds are reported at original cost. The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces) Which region in georgia is deepwater parts found in how does the author use of the word tusk inform the reader the angles of a qaudileteral are x,2x,100 and 110 degress find the value of 2x Helppppppppppppppppp Every weekday after tennis practice, Will buys either a carton of milk or a bottleof power drink.Suppose that m is the number of cartons of milk that Will purchased duringthe last month. His total cost for beverages in dollars last month can berepresented by the algebraic expression 2m + 3 (20 m).Which of the following statements are true? Select all that apply.The cost of the power drink is $3 per bottle,Will purchased 20 more bottles of power drink than cartons of milk.Will purchased a total of 20 beverages during the last month.The total amount Will spent on power drinks was $60An equivalent expression for the total cost of Will's beverages during this month is60 - m dollarsWill purchased 20 more cartons of milk than bottles of power drink Determine the account balance of a simple interest account if the principal is $10,000, the interest rate is 1.5%, and the time is 5 years. from chapter 3 of animal farm the pigs set aside the harness room as a headquarters for themselves whay does this foreshadow? Psychology is considered as whattype of science?A. MedicalB. HistoricalC. Social uppose you are titrating an acid of unknown concentration with a standardized base. At the beginning of the titration, you read the base titrant volume as 2.04 mL. After running the titration and reaching the endpoint, you read the base titrant volume as 20.95 mL. What volume, in mL, of base was required for the titration? what has led nepal to be rich in customer and tradition