Which of the following particles found in an atom have charges?
A. only protons
B. only electrons
C. electrons and neutrons
D. protons and electrons

Answers

Answer 1

Answer:

D. Protons and electrons

Explanation:

Atoms consist of three basic particles: protons, electrons, and neutrons. The nucleus (center) of the atom contains the protons (positively charged) and the neutrons (no charge). The outermost regions of the atom are called electron shells and contain the electrons (negatively charged).


Related Questions

Explain how the coronavirus is an example of viral evolution

Answers

Answer:the virus seems to keep changing and adapting

Explanation:

For example they have found that it now attacks your kidneys heavily causing failure when in the beginning it did not

Atoms of elements that are in the same group have the same number of
O protons
O protons and neutrons
O principle energy level
O valence electrons

Answers

Atoms are grouped together by their number of valence electrons

A patient is prescribed 6 mg of cough medication. The label on the prescription says there are 2 mg per 4 mL. How many teaspoons of cough medication does the patient need to take?

Answers

Answer:

2.4 teaspoons

hope it helps;)

Which of the following functions would most likely be affected if the mitochondria was damaged?
O A. Protein production
OB.
A. Energy production
OC. A. Waste removal
O D.
A. Lipid production

Answers

Answer: i think its OB.

Explanation

Which of the following represents the flow of information within a cell?
A. RNA> protein>DNA.
B. DNA> protein.
C. DNA> RNA> protein.
D. DNA> protein > RNA.

Answers

Answer:C. DNA> RNA> protein

Explanation:

Information flows from DNA to RNA to Protein. The process start with replication of information into a new strand of Deoxyribonucliec acid from a template strand this information are in coded in Nitrogenous Bases after which the information transfered to an intermediary ribonucliec acid called the messanger RNA this process is called transcription, mRNA then transfer the information to the ribosome where translation will take place into an amino acid sequence or a functional protein with the help of transferase enzyme. The amino acid then specifies the information that is coded in the form of Nitrogenous Organic bases.

Therefore, information moves from DNA(replication) to RNA(transcription) to Protein(Translation).

Help ASAP

in full sentences, describe how you would estimate the size of a specimen under a microscope

Answers

Answer:

Estimating the size of different specimens can be done using a slide rule or a transparent metric ruler with the different objective lenses.

Explanation:

I know you don't need this now but here's for future reference .. Sorry :/

Specimens that may be introduced into evidence in a court of law require special handling. What is the documentation for this type of specimen called?

Answers

Answer:

chain of custody

Food webs provide a more complete model of interactions in the ecosystem because-

Answers

Answer Food webs consist of many interconnected food chains and are more realistic representation of consumption relationships in ecosystems.

Explanation:

Instructions: In this lab, you will investigate how limiting factors affect a population of cricket frogs in the Florida Everglades. Your scientific inquiry will focus on three limiting factors: food, predators, and pollution. Complete the following lab report to record your observations as you move through the simulation. You will submit your completed lab report for grading.
in this experiment what will be
Test variable (independent variable):
Outcome variable (dependent variable):
Control group:
will give brainliest!!!

Answers

Answer:

Objective: The purpose of this lab is to find out the effect increasing and decreasing limiting factors has on the Floridian Cricket frogs in the Everglades as well as obtain new knowledge on their habits and lifestyle.

Hypothesis: If the predators are increased, then the Cricket frog population will decrease over the span of five years.

If the pollution is increased then the population of the Cricket frog will decrease in the span of five years.

If the amount of food is increased then the population of the Cricket frog will increase over the span of five years.

Procedure: The independent variable is      Their effect                  . The dependant variable is the increase/decrease of the Cricket frog population

Explanation: These are the affect of the increase/decrease of the frog population.

Answer: what they said

Explanation:

in an oil spill why doesn't the oil mix in with the sea water

Answers

Answer: because oil is less dense than water and therefore it floats to the surface.

Explanation:

Describe a non-biological hierarchy that exists in everyday life and how it relates to a biological system.​

Answers

Answer:

The military is a hierarchy.

The military is a hierarchy.

Explanation:

A hierarchy is an arrangement of items in which the items are represented as being "above", "below", or "at the same level as" one another. Hierarchy is an important concept in a wide variety of fields, such as philosophy, mathematics, computer science, organizational theory, systems theory, and the social sciences.

To be classified as a living organism an object must be made of at least one cell
a. True
b. False

Answers

Answer:

It is A

Explanation:

What will happen if a person doesn’t consume the minimum daily amount of carbohydrates

Answers

Answer:

Explanation:

If you don't consume the right amount your blood sugar can drop below normal. Then your body will burn fat for energy.

What information can scientists obtain from these fossils?

temperatures
number of species that existed
movement of continents
cause of mass extinctions

Answers

Answer:

temperatures

Explanation:

The presence of fossils representative of these organisms can tell us a great deal about the environments of the past; what the climate was like, and what sorts of plants and animals inhabited the landscape. Some fossils provide a continuous record of environmental change.

BRAINLIEST!! Are frogs reptiles or amphibians.

Answers

Answer:

amphibians because it is a cold blooded vertebrate and has aquatic gill breathing larvea

Explanation:

They are cold blooded reptiles

Two siblings live in a two-story house with a heating and cooling unit for each floor. The two have decided to conduct an experiment to determine the need to turn both units on throughout the daytime during the winter to stay warm.



They decided to use both units for two weeks and recorded their observations. The following two weeks, they only used the downstairs unit and recorded their observations.



Every day they charted whether upstairs and downstairs were either too cold, cold, warm, too warm, or hot. They tallied their results, learning that the two weeks of using both units; the house was a bit too warm. The month where only the downstairs unit was used, they noted downstairs and upstairs were warm. This did not support their prediction that it would be cold.



They began to wonder how upstairs could still be warm during the daytime when only using the downstairs unit. What is the best possible explanation for upstairs being warm throughout the winter month when they only turned on the downstairs unit?

Answers

Answer:

Convection

Explanation:

Hot air rises as it has less particles and more volume. This means that when they heat downstairs, the hot air rises to the top. Then, it cools and sinks because cold air has more particles and less volume. It heats up again from the downstairs unit and the cycle keeps going. This is called convection

Answer:

The volume of warm air expands and rises, warming the whole house through convection.

Explanation:

what is the meaning of endogenic

Answers

Answer:

formed or occurring beneath the surface of the earth

formed or occurring internally :)

Help it’s science if u don’t mind! Thx!

Answers

Bottom-producers (plants) 1000
Primary consumers (herbivores) 100
Secondary consumers 10
Tertiary consumers (top) 1

2.) how do scientists predict the polarity of molecules?
Pls help?!!

Answers

Electronegativity.

If the difference in electronegativity for the atoms in a bond is greater than 0.4, we consider the bond polar. If the difference in electronegativity is less than 0.4, the bond is essentially nonpolar.

11. In the 1960's, scientists discovered the mechanism that was responsible for
plate movement, which is?

Answers

Answer:

plate tectonics

Explanation:

The idea that the seafloor itself moves and also carries the continents with it as it spreads from a central rift axis was proposed by Harold Hammond Hess from Princeton University and Robert Dietz of the U.S. Naval Electronics Laboratory in San Diego in the 1960s. The phenomenon is known today as plate tectonics.

how will win in a fight hulk are one punch man ?

Answers

One punch man of course

Answer: One punch man will win

Explanation  Because hulk can't really dodge anything and he is strong but one punch man will actually beat him it obvious

Two scientists do not agree on which type of grocery bag is better for the environment what is the most likely outcome of the disagreement

Answers

They will most likely decide to eliminate using grocery bags period.

Fill in the blank: Researchers who seek to replace damaged genes that cause inherited diseases or to genetically engineer bacteria are studying ________


A. Zoology


B. Planets


C. Ecology


D. Biotechnology

Answers

Answer:

D. Biotechnology

Explanation:

Biotechnology is the use of living organisms in technological applications. It involves using technological practices and principles in manipulating living organisms in order to produce beneficial products.

One aspect of biotechnology is genetic engineering or genetic modification which entails changing the genetic content of an organism to suit desirable effects. Hence, researchers trying to replace damaged genes that cause inherited diseases or to genetically engineer bacteria are studying BIOTECHNOLOGY.

• Water molecules attracted to _____________ objects (because of their polarity and hydrogen bonds)

Answers

Answer:

• Water molecules attracted to other objects (because of their polarity and hydrogen bonds)

Explanation:

Which of the following is a primary function of the cell membrane?

Choose 1 answer:

(Choice A) DNA replication

(Choice B) Protecting organelles

(Choice C) Protein synthesis

(Choice D) Filling space between cell organelles

Answers

Answer:

(Choice B) Protecting organelles

Explanation:

As it is outer most layer so it protect the cell and it's organelles.

Answer:

Protecting organelles

Explanation:

6. What kind of mineral ID is this?
please hurry thank you!!

Answers

Answer:

It is a streak ID

Explanation:

Streak is the color of the powder of a mineral. To do a streak test, you scrape the mineral across an unglazed porcelain plate. The plate is harder than many minerals, causing the minerals to leave a streak of powder on the plate

Which of these lists presents which of the stages of the cell cycle in the correct order?
A. interphase, mitosis, cytokinesis
B. cytokinesis, mitosis, interphase
C. mitosis, interphase, cytokinesis
D. interphase, cytokinesis, mitosis

Answers

D is the answer ccycfuf

The lists presents which of the stages of the cell cycle in the correct order should be option D. interphase, cytokinesis, mitosi

The following information should be considered:

Interphase - where the cell prepares for Mitosis. During this stage the cell grows and replicates DNA.Mitosis - where the chromosomes are separated and are separated into 2 nuclei.Cytokinesis - where cells officially splits into two daughter cells.

learn more: https://brainly.com/question/4626564?referrer=searchResults

in a hydrogen bond a weak bond is formed between what

Answers

Answer:

slightly positive and slightly negative charges of polar covalent molecules, such as water.

Bill is a young man who has noticed lately that he cannot remember new information. He forgets the names of people he just met, is constantly losing his keys and is having trouble at work as an accountant because he cannot remember information his clients tell him. This has not been a problem until very recently and he is not having trouble remembering other older memories such as his families’ names and his address. What is the name of the part of the brain that is not working?

Answers

Answer:

cerebrum

Explanation:

cerebrum is the seat of consciousness, intelligence, memory, judgement, learning and interpreter of sensation and imagination.

Cerebrum is the part of the brain that is not working.

What is Cerebrum?

The cerebral hemispheres are the two hemispheres, or halves, that make up this structure. Speech, thought, emotions, reading, writing, and learning are all governed by regions of the cerebrum.

The largest and topmost part of the brain is called the cerebrum. Two-thirds of the weight of the brain is made up of the cerebral hemispheres, which make up the cerebrum.

Language and speech are governed by the functionally dominant hemisphere, which is often the left. The opposing hemisphere decodes spatial and visual information.

Therefore, Cerebrum is the part of the brain that is not working.

To learn more about cerebrum, refer to the link:

https://brainly.com/question/28394574

#SPJ2

What is 1 example of Commensalism?

Answers

Answer:

Shark and remora fish

Explanation:

Here are some more ; just in case ;

Oyster and ClamMan and intestinal bacteria

Stay home, Stay safe

Bye <3

Answer:

Remora fish have a disk on their heads that makes them able to attach to larger animals, such as sharks, mantas, and whales. When the larger animal feeds, the remora detaches itself to eat the extra food.

Explanation

Can This Helppp

Other Questions
Alicia had a checking account balance of -$11.00. She completed some chores to earn $44.50 and deposited it into her account. She decided to treat herself and a friend to go see a movie. Each ticket cost $6.25. How much money does she now have in her checking account?SHOW WORK or i'll just take ur answer off The temperature outside is 22 degrees C. What is this temperature in degrees Fahrenheit? Write hour answer as a decimal Which of Hidesatos traits is demonstrated in this excerpt and is characteristic of a folktale? my daughters homework is killing me short read Which is the solution set of: 5(x+3)10x>10? The legislative branch is..a.responsible for enforcing the lawb.divided into two seperate houses c.accountable for conducting trialsd.less powerful than the executive Which of the following verbs is reflexive?hablarcomervivirlevantarse Precision Manufacturing had the following operating results for 2014: sales = $38,900; cost of goods sold = $24,600; depreciation expense = $1,700; interest expense = $1,400; dividends paid = $1,000. At the beginning of the year, net fixed assets were $14,300, current assets were $8,700, and current liabilities were $6,600. At the end of the year, net fixed assets were $13,900, current assets were $9,200, and current liabilities were $7,400. The tax rate for 2014 was 34 percent. What is the cash flow from assets for 2014? State whether the following sentences are true or false regarding the nature of fiduciary-type funds and the accounting measurements within them. If the sentence is false, state why. a. Governments may access the resources of fiduciary funds to help support their own programs. b. When a government sponsors an Investment Trust Fund, the portion that belongs to other governments is reported as assets of the Fund, but the portion belonging to the sponsoring government is not. c. The statement of net position for a typical Agency Fund shows assets and liabilities, but no fund balance. d. When reporting on the resources of Pension Trust Funds, equity securities held by the Funds are reported at original cost. The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces) Which region in georgia is deepwater parts found in how does the author use of the word tusk inform the reader the angles of a qaudileteral are x,2x,100 and 110 degress find the value of 2x Helppppppppppppppppp Every weekday after tennis practice, Will buys either a carton of milk or a bottleof power drink.Suppose that m is the number of cartons of milk that Will purchased duringthe last month. His total cost for beverages in dollars last month can berepresented by the algebraic expression 2m + 3 (20 m).Which of the following statements are true? Select all that apply.The cost of the power drink is $3 per bottle,Will purchased 20 more bottles of power drink than cartons of milk.Will purchased a total of 20 beverages during the last month.The total amount Will spent on power drinks was $60An equivalent expression for the total cost of Will's beverages during this month is60 - m dollarsWill purchased 20 more cartons of milk than bottles of power drink Determine the account balance of a simple interest account if the principal is $10,000, the interest rate is 1.5%, and the time is 5 years. from chapter 3 of animal farm the pigs set aside the harness room as a headquarters for themselves whay does this foreshadow? Psychology is considered as whattype of science?A. MedicalB. HistoricalC. Social uppose you are titrating an acid of unknown concentration with a standardized base. At the beginning of the titration, you read the base titrant volume as 2.04 mL. After running the titration and reaching the endpoint, you read the base titrant volume as 20.95 mL. What volume, in mL, of base was required for the titration? what has led nepal to be rich in customer and tradition